OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

KCTD1 (NM_001136205) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC226740
KCTD1 (Myc-DDK-tagged)-Human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA331513 Rabbit Polyclonal Anti-KCTD1 Antibody
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "KCTD1 or NM_001136205"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol KCTD1
Synonyms C18orf5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC226740 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCAAGACCTCTGATCACTAGATCCCCTGCATCTCCACTGAACAACCAAGGCATCCCTACTCCAGCAC
AACTCACAAAATCCAATGCACCTGTCCACATTGATGTGGGCGGCCACATGTACACCAGCAGCCTGGCCAC
CCTCACCAAATACCCTGAATCCAGAATCGGAAGACTTTTTGATGGTACAGAGCCCATTGTTTTGGACAGT
CTCAAACAGCACTATTTCATTGACAGAGATGGACAGATGTTCAGATATATCTTGAATTTTCTACGAACAT
CCAAACTCCTCATTCCTGATGATTTCAAGGACTACACTTTGTTATATGAAGAGGCAAAATATTTTCAGCT
TCAGCCCATGTTGTTGGAGATGGAAAGATGGAAGCAGGACAGAGAAACTGGTCGATTTTCAAGGCCCTGT
GAGTGCCTCGTCGTGCGTGTGGCCCCAGACCTCGGAGAAAGGATCACGCTAAGCGGTGACAAATCCTTGA
TAGAAGAAGTATTTCCAGAGATCGGCGACGTGATGTGTAACTCTGTCAATGCAGGCTGGAATCACGACTC
GACGCACGTCATCAGGTTTCCACTAAATGGCTACTGTCACCTCAACTCAGTCCAGGTCCTCGAGAGGTTG
CAGCAAAGAGGATTTGAAATCGTGGGCTCCTGTGGGGGAGGAGTAGACTCGTCCCAGTTCAGCGAATACG
TCCTTCGGCGGGAACTGAGGCGGACGCCCCGTGTACCCTCCGTCATCCGGATAAAGCAAGAGCCTCTGGA
C

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC226740 protein sequence
Red=Cloning site Green=Tags(s)

MSRPLITRSPASPLNNQGIPTPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPESRIGRLFDGTEPIVLDS
LKQHYFIDRDGQMFRYILNFLRTSKLLIPDDFKDYTLLYEEAKYFQLQPMLLEMERWKQDRETGRFSRPC
ECLVVRVAPDLGERITLSGDKSLIEEVFPEIGDVMCNSVNAGWNHDSTHVIRFPLNGYCHLNSVQVLERL
QQRGFEIVGSCGGGVDSSQFSEYVLRRELRRTPRVPSVIRIKQEPLD

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001136205
ORF Size 771 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001136205.2, NP_001129677.1
RefSeq Size 2174 bp
RefSeq ORF 774 bp
Locus ID 284252
UniProt ID Q719H9, A0A024RC45
Cytogenetics 18q11.2
Protein Families Ion Channels: Other
MW 29.4 kDa
Summary This gene encodes a protein containing a BTB (Broad-complex, tramtrack and bric a brac), also known as a POZ (POxvirus and zinc finger) protein-protein interaction domain. The encoded protein negatively regulates the AP-2 family of transcription factors and the Wnt signaling pathway. A mechanism for the modulation of Wnt signaling has been proposed in which the encoded protein enhances ubiquitination and degradation of the beta-catenin protein. Mutations in this gene have been identified in Scalp-ear-nipple (SEN) syndrome. provided by RefSeq, May 2017
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001136205" in other vectors (4)
SKU Description Size Price
RC226740L3 Lenti ORF clone of Human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC226740L4 Lenti ORF clone of Human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 1, mGFP tagged 10 ug
$600.00
RG226740 KCTD1 (tGFP-tagged) - Human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 1 10 ug
$489.00 $500.00
SC324858 KCTD1 (untagged)-Human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 1 10 ug
$330.00

Plasmid Map for RC226740

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC226740
Circular map for RC226740

file-alt Citations

KCTD1/KCTD15 complexes control ectodermal and neural crest cell functions and their impairment causes aplasia cutis
Raymundo, Zhang, Smaldone et al
J Clin Invest (2023)
AI Summary: In this study, OriGene’s human C-terminal Myc-DDK-tagged KCTD1 (RC226740), KCTD15 (RC200838), and the pCMV6-Entry vector (PS100001) were used to overexpress the proteins in HEK293 cells, enabling the investigation of KCTD1/KCTD15 complex formation and function in ectodermal and neural crest cell biology.
Snippet: … Why it forms Save;FLAG-tagged KCTD1 (human C-terminal Myc-DDK-tagged KCTD1, transcript variant 1, pCMV6- 10 Entry vector, RC226740, Origene), FLAG-tagged KCTD15 (human C-terminal Myc-DDK-tagged 11 KCTD15, transcript variant 1, pCMV6-Entry vector, RC200838, Origene), or the pCMV6-Entry 12 vector (C-terminal Myc-DDK tag, PS100001, Origene), were overexpressed in HEK293 cells. 13 Immunoprecipitation was performed 48 hours after transfection using a monoclonal anti-DDK
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products