OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RABL2B (NM_001130923) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC225301
RABL2B (Myc-DDK-tagged)-Human RAB, member of RAS oncogene family-like 2B (RABL2B), transcript variant 7
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA365202 RABL2B rabbit polyclonal antibody
100 ul
$310.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "RABL2B or NM_001130923"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RABL2B
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC225301 representing NM_001130923
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGAAGACAAAACCAAACCGAGTGAGTTGGACCAAGGGAAGTATGATGCTGATGACAACGTGAAGA
TCATCTGCCTGGGAGACAGCGCAGTGGGCAAATCCAAACTCATGGAGAGATTTCTCATGGATGGCTTTCA
GCCACAGCAGCTGTCCACGTACGCCCTGACCCTGTACAAGCACACAGCCACGGTAGATGGAAGGACCATC
CTTGTGGACTTTTGGGACACGGCAGGCCAGGAGCGGTTCCAGAGCATGCATGCCTCCTACTACCACAAGG
CCCACGCCTGCATCATGGTGTTTGATGTACAGAGGAAAGTCACCTATAGGAACCTGAGCACCTGGTATAC
AGAGCTTCGGGAGTTCAGGCCAGAGATCCCATGCATCGTGGTGGCCAATAAAATTGATGACATAAACGTG
ACCCAAAAAAGCTTCAATTTTGCCAAGAAGTTCTCCCTGCCCCTGTATTTCGTCTCGGCTGCTGATGGTA
CCAATGTTGTGAAGGTGTGGTTGACTGCAGAGGTAGCTAGCAAGCTCTTCAATGATGCAATTCGATTAGC
TGTGTCTTACAAACAGAACTCCCAGGACTTCATGGATGAGATTTTTCAGGAGCTCGAGAACTTCAGCTTG
GAGCAGGAAGAGGAGGACGTGCCAGACCAGGAACAGAGCAGCAGCATCGAGACCCCATCAGAGGAGGCGG
CCTCTCCCCACAGC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC225301 representing NM_001130923
Red=Cloning site Green=Tags(s)

MAEDKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGRTI
LVDFWDTAGQERFQSMHASYYHKAHACIMVFDVQRKVTYRNLSTWYTELREFRPEIPCIVVANKIDDINV
TQKSFNFAKKFSLPLYFVSAADGTNVVKVWLTAEVASKLFNDAIRLAVSYKQNSQDFMDEIFQELENFSL
EQEEEDVPDQEQSSSIETPSEEAASPHS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001130923
ORF Size 714 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001130923.3
RefSeq ORF 717 bp
Locus ID 11158
UniProt ID Q9UNT1
Cytogenetics 22q13.33
Protein Families Druggable Genome
MW 27 kDa
Summary The RABL2B protein is a member of the RAB gene family which belongs to the RAS GTPase superfamily. RABL2B is located within a subtelomeric region of 22q13.3. Multiple alternatively spliced transcript variants encoding several different isoforms have been found for this gene. provided by RefSeq, Aug 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001130923" in other vectors (4)
SKU Description Size Price
RC225301L3 Lenti ORF clone of Human RAB, member of RAS oncogene family-like 2B (RABL2B), transcript variant 7, Myc-DDK-tagged 10 ug
$600.00
RC225301L4 Lenti ORF clone of Human RAB, member of RAS oncogene family-like 2B (RABL2B), transcript variant 7, mGFP tagged 10 ug
$600.00
RG225301 RABL2B (tGFP-tagged) - Human RAB, member of RAS oncogene family-like 2B (RABL2B), transcript variant 7 10 ug
$500.00
SC325647 RABL2B (untagged)-Human RAB, member of RAS oncogene family-like 2B (RABL2B), transcript variant 7 10 ug
$330.00

Plasmid Map for RC225301

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC225301
Circular map for RC225301

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products