OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TIMM50 (NM_001001563) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC224744
TIMM50 (Myc-DDK-tagged)-Human translocase of inner mitochondrial membrane 50 homolog (S. cerevisiae) (TIMM50), nuclear gene encoding mitochondrial protein
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA811603 TIMM50 mouse monoclonal antibody,clone OTI1E9 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "TIMM50 or NM_001001563"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TIMM50
Synonyms MGCA9; TIM50; TIM50L
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC224744 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTCAGCTTTATCTCTGGGCAATAAGTGTGATCCCTTCCTTCGCTGCGTCCTTTGCAGGGGCGGTG
GCGCTCTGCAAGGCCCAAGGGGGCGTGGTCCAGATGACTTTGAATCCCAGTTGTCGCCCCCAGGGTCAGC
CAGGAGACTAGTCAGAAGCAAACGCGCCTGCGGCAATCCGCCCGATGCCTTTGGTCTCTCTCGGGCTTCC
GTCCACCCGCCCCTCCCCCGCGTTTCCATTGGCTGTACCTCCGGCCCGGGGCGGGCGAAGAGGGAGCGAG
TGGGCGGGGCCGCGTGGCGTCAGCGCAAGATGGCGGCCTCGGCAGCGGTGTTCTCGCGCTTGCGAAGCGG
GCTCCGGCTCGGCTCGCGGGGACTGTGCACGAGGTTGGCGACGCCGCCCCGCCGGGCCCCAGATCAGGCC
GCAGAGATCGGGAGCCGCGGGAGCACTAAGGCGCAAGGGCCACAGCAGCAGCCGGGCTCAGAGGGTCCCA
GCTATGCCAAAAAAGTTGCGCTCTGGCTTGCTGGGCTGCTTGGAGCTGGTGGGACTGTGAGCGTCGTCTA
TATCTTTGGAAACAACCCGGTGGACGAAAATGGTGCCAAGATTCCTGATGAGTTCGACAATGATCCAATT
CTGGTACAGCAGTTGCGCCGGACATACAAATATTTCAAAGATTATAGACAGATGATCATCGAGCCCACCA
GCCCTTGCCTTCTCCCAGACCCTCTGCAGGAACCGTACTACCAGCCACCCTACACGCTCGTTTTGGAGCT
CACCGGCGTCCTCTTGCATCCTGAGTGGTCGCTGGCCACTGGCTGGAGGTTTAAGAAGCGCCCAGGCATC
GAGACCTTGTTCCAGCAGCTTGCCCCTTTATATGAAATTGTCATCTTTACGTCAGAGACTGGCATGACTG
CGTTTCCACTCATTGATAGTGTGGACCCCCATGGCTTCATCTCCTACCGCCTATTCCGGGACGCCACAAG
ATACATGGATGGACACCATGTAAAGGATATTTCATGTCTGAATCGGGACCCAGCTCGAGTAGTAGTTGTG
GACTGCAAGAAGGAAGCCTTCCGCCTGCAGCCCTATAACGGCGTTGCCCTGCGGCCCTGGGACGGCAACT
CTGATGACCGGGTCTTGTTGGATCTGTCTGCCTTCCTCAAGACCATTGCACTGAATGGTGTGGAGGACGT
GCGAACCGTGCTGGAGCACTATGCCCTGGAGGATGACCCGCTGGCGGCTTTCAAACAGCGGCAAAGCCGG
CTAGAGCAGGAGGAGCAGCAGCGCCTGGCCGAGCTCTCCAAGTCCAACAAGCAGAACCTCTTCCTTGGCT
CCCTCACCAGCCGCTTGTGGCCTCGCTCCAAACAGCCC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC224744 protein sequence
Red=Cloning site Green=Tags(s)

MASALSLGNKCDPFLRCVLCRGGGALQGPRGRGPDDFESQLSPPGSARRLVRSKRACGNPPDAFGLSRAS
VHPPLPRVSIGCTSGPGRAKRERVGGAAWRQRKMAASAAVFSRLRSGLRLGSRGLCTRLATPPRRAPDQA
AEIGSRGSTKAQGPQQQPGSEGPSYAKKVALWLAGLLGAGGTVSVVYIFGNNPVDENGAKIPDEFDNDPI
LVQQLRRTYKYFKDYRQMIIEPTSPCLLPDPLQEPYYQPPYTLVLELTGVLLHPEWSLATGWRFKKRPGI
ETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVKDISCLNRDPARVVVV
DCKKEAFRLQPYNGVALRPWDGNSDDRVLLDLSAFLKTIALNGVEDVRTVLEHYALEDDPLAAFKQRQSR
LEQEEQQRLAELSKSNKQNLFLGSLTSRLWPRSKQP

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001001563
ORF Size 1368 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001001563.3, NP_001001563.1
RefSeq Size 2572 bp
RefSeq ORF 1062 bp
Locus ID 92609
UniProt ID Q3ZCQ8
Cytogenetics 19q13.2
MW 50.5 kDa
Summary This gene encodes a subunit of the TIM23 inner mitochondrial membrane translocase complex. The encoded protein functions as the receptor subunit that recognizes the mitochondrial targeting signal, or presequence, on protein cargo that is destined for the mitochondrial inner membrane and matrix. This protein may also play a role in maintaining the membrane permeability barrier, and knockdown of this gene in human cells results in the release of cytochrome c and apoptosis. provided by RefSeq, Jul 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001001563" in other vectors (6)
SKU Description Size Price
RC224744L1 Lenti ORF clone of Human translocase of inner mitochondrial membrane 50 homolog (S. cerevisiae) (TIMM50), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$757.00
RC224744L2 Lenti ORF clone of Human translocase of inner mitochondrial membrane 50 homolog (S. cerevisiae) (TIMM50), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$757.00
RC224744L3 Lenti ORF clone of Human translocase of inner mitochondrial membrane 50 homolog (S. cerevisiae) (TIMM50), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$757.00
RC224744L4 Lenti ORF clone of Human translocase of inner mitochondrial membrane 50 homolog (S. cerevisiae) (TIMM50), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$757.00
RG224744 TIMM50 (tGFP-tagged) - Human translocase of inner mitochondrial membrane 50 homolog (S. cerevisiae) (TIMM50), nuclear gene encoding mitochondrial protein 10 ug
$657.00
SC300219 TIMM50 (untagged)-Human translocase of inner mitochondrial membrane 50 homolog (S. cerevisiae) (TIMM50), nuclear gene encoding mitochondrial protein 10 ug
$503.00

Plasmid Map for RC224744

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC224744
Circular map for RC224744

file-alt Citations

TIMM50 promotes tumor progression via ERK signaling and predicts poor prognosis of non-small cell lung cancer patients
Zhang, Han, Zhou et al
Mol. Carcinog. (2019)
AI Summary: OriGene products, specifically the pCMV6-ddk-myc and pCMV6-ddk-myc-TIMM50 plasmids, were used in this study to manipulate TIMM50 expression in NSCLC cells, enabling the investigation of TIMM50's role in tumor progression and ERK signaling.
Snippet: Israel). Plasmid transfection and small interfering RNA treatment Plasmids pCMV6-ddk-myc and pCMV6-ddk-myc-TIMM50 were purchased from Origene (RC224744, Rockville, MD, USA). TIMM50-siRNA (sc-63129) and NC
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products