OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SCN4B (NM_174934) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC223951
SCN4B (Myc-DDK-tagged)-Human sodium channel, voltage-gated, type IV, beta (SCN4B), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
  $450.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA326109 Rabbit polyclonal SCN4B antibody
100 ul
$380.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "SCN4B or NM_174934"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SCN4B
Synonyms ATFB17; LQT10; Navbeta4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC223951 representing NM_174934
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCGGGGCTGGGGACGGAGGCAAAGCCCCGGCGAGATGGCTGGGCACTGGGCTTTTGGGCCTCTTCC
TGCTCCCCGTAACCCTGTCGCTGGAGGTGTCTGTGGGAAAGGCCACCGACATCTACGCTGTCAATGGCAC
GGAGATCCTGCTGCCCTGCACCTTCTCCAGCTGCTTTGGCTTCGAGGACCTCCACTTCCGGTGGACCTAC
AACAGCAGTGACGCATTCAAGATTCTCATAGAGGGGACTGTGAAGAATGAGAAGTCTGACCCCAAGGTGA
CGTTGAAAGACGATGACCGCATCACTCTGGTAGGCTCTACTAAGGAGAAGATGAACAACATTTCCATTGT
GCTGAGGGACCTGGAGTTCAGCGACACGGGCAAATACACCTGCCATGTGAAGAACCCCAAGGAGAATAAT
CTCCAGCACCACGCCACCATCTTCCTCCAAGTCGTTGATAGACTGGAAGAAGTGGACAACACAGTGACAC
TCATCATCCTGGCTGTCGTGGGCGGGGTCATCGGGCTCCTCATCCTCATCCTGCTGATCAAGAAACTCAT
CATCTTCATCCTGAAGAAGACTCGGGAGAAGAAGAAGGAGTGTCTCGTGAGCTCCTCGGGGAATGACAAC
ACGGAGAACGGCTTGCCTGGCTCCAAGGCAGAGGAGAAACCACCTTCAAAAGTG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC223951 representing NM_174934
Red=Cloning site Green=Tags(s)

MPGAGDGGKAPARWLGTGLLGLFLLPVTLSLEVSVGKATDIYAVNGTEILLPCTFSSCFGFEDLHFRWTY
NSSDAFKILIEGTVKNEKSDPKVTLKDDDRITLVGSTKEKMNNISIVLRDLEFSDTGKYTCHVKNPKENN
LQHHATIFLQVVDRLEEVDNTVTLIILAVVGGVIGLLILILLIKKLIIFILKKTREKKKECLVSSSGNDN
TENGLPGSKAEEKPPSKV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_174934
ORF Size 684 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_174934.4
RefSeq Size 4489 bp
RefSeq ORF 687 bp
Locus ID 6330
UniProt ID Q8IWT1, B0YJ93
Cytogenetics 11q23.3
Protein Families Ion Channels: Sodium, Transmembrane
MW 22 kDa
Summary The protein encoded by this gene is one of several sodium channel beta subunits. These subunits interact with voltage-gated alpha subunits to change sodium channel kinetics. The encoded transmembrane protein forms interchain disulfide bonds with SCN2A. Defects in this gene are a cause of long QT syndrome type 10 (LQT10). Three protein-coding and one non-coding transcript variant have been found for this gene.provided by RefSeq, Mar 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_174934" in other vectors (6)
SKU Description Size Price
RC223951L1 Lenti ORF clone of Human sodium channel, voltage-gated, type IV, beta (SCN4B), transcript variant 1, Myc-DDK-tagged 10 ug
$750.00
RC223951L2 Lenti ORF clone of Human sodium channel, voltage-gated, type IV, beta (SCN4B), transcript variant 1, mGFP tagged 10 ug
$750.00
RC223951L3 Lenti ORF clone of Human sodium channel, voltage-gated, type IV, beta (SCN4B), transcript variant 1, Myc-DDK-tagged 10 ug
$750.00
RC223951L4 Lenti ORF clone of Human sodium channel, voltage-gated, type IV, beta (SCN4B), transcript variant 1, mGFP tagged 10 ug
$750.00
RG223951 SCN4B (tGFP-tagged) - Human sodium channel, voltage-gated, type IV, beta (SCN4B), transcript variant 1 10 ug
$650.00
SC123982 SCN4B (untagged)-Human sodium channel, voltage-gated, type IV, beta (SCN4B), transcript variant 1 10 ug
$450.00

Plasmid Map for RC223951

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC223951
Circular map for RC223951

file-alt Citations

Identification of rare variants in cardiac sodium channel β4‑subunit gene SCN4B associated with ventricular tachycardia
Yang, Xiong, Xu et al
Mol. Genet. Genomics (2019) 294 (4), 1059-1071 DOI: 10.1007/s00438-019-01567-7
Snippet: The cDNA for human cardiac sodium channel gene SCN5A was cloned into vector pcDNA3 (pcDNA3-Nav1.5) as described (Dumaine et al. 1996;Chen et al. 1998;Huang et al. 2016). Human SCN4B cDNA was purchased from Origene (pCMV6-XL4-SCN4B, NM_174934
Intrinsic CD4(+) T cell sensitivity and response to a pathogen are set and sustained by avidity for thymic and peripheral complexes of self peptide and MHC
Persaud, Parker, Lo et al
Nat. Immunol. (2014) 15 (3), 266-74 DOI: 10.1038/ni.2822
Cited by 178
AI Summary: OriGene’s human SCN4B cDNA (RC223951) was used as a template for PCR amplification and subsequent cloning into plasmid pcDNA3.1, contributing to the molecular tools utilized in this study.
Snippet: The human SCN5A–green fluorescent protein construct was a gift from K. Murray45. The cDNA encoding human SCN4B (RC223951;Origene) was amplified by PCR and cloned into plasmid pcDNA3.1
A voltage-gated sodium channel is essential for the positive selection of CD4(+) T cells
Lo, Donermeyer, Allen
Nat. Immunol. (2012) 13 (9), 880-7 DOI: 10.1038/ni.2379
Cited by 110
AI Summary: OriGene products contributed to this study by providing shRNA constructs (OriGene, TL502431) used for in vivo knockdown of the VGSC regulatory β-subunit gene, enabling the authors to demonstrate the essential role of this channel in the positive selection of CD4(+) T cells.
Snippet: but not CD8 + T cells. In vivo short hairpin RNA (shRNA)-mediated knockdown of the gene encoding a regulatory β-subunit of a VGSC specifically inhibited the positive selection of CD4 + T cells. Ectopic expression of VGSC
FigureFigureFigure
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products