OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RTL3 (NM_152694) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC223801
ZCCHC5 (Myc-DDK-tagged)-Human zinc finger, CCHC domain containing 5 (ZCCHC5)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "RTL3 or NM_152694"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RTL3
Synonyms Mar3; Mart3; SIRH9; ZCCHC5; ZHC5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC223801 representing NM_152694
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGGAGGACTTAGCAGCCTCCTATATTGTTCTGAAATTGGAGAATGAAATTCGGCAGGCTCAAGTGC
AGTGGCTGATGGAAGAAAATGCTGCTCTCCAGGCCCAGATCCCAGAGCTTCAGAAGTCCCAAGCAGCCAA
GGAGTATGATCTACTCCGAAAGTCCTCAGAGGCCAAGGAGCCCCAGAAGCTCCCAGAGCACATGAATCCC
CCAGCAGCCTGGGAGGCCCAAAAGACCCCAGAGTTCAAGGAACCCCAGAAGCCACCAGAGCCACAGGATC
TTCTACCCTGGGAACCCCCAGCAGCCTGGGAACTCCAGGAGGCCCCAGCAGCCCCAGAGTCCCTGGCGCC
TCCAGCAACCCGGGAGTCCCAGAAACCTCCAATGGCCCATGAGATCCCAACAGTCTTGGAGGGCCAGGGG
CCTGCAAACACCCAGGATGCCACAATAGCCCAAGAGCCCAAGAATTCAGAACCCCAGGATCCCCCAAATA
TTGAGAAGCCCCAGGAGGCACCAGAATACCAGGAAACTGCAGCACAGCTAGAGTTCCTTGAGCTTCCACC
TCCCCAGGAGCCTCTGGAGCCTTCAAATGCCCAGGAATTCCTAGAACTCTCAGCAGCCCAGGAGTCCCTG
GAGGGTCTAATAGTTGTGGAGACATCAGCAGCTTCAGAGTTTCCACAGGCCCCTATTGGGTTAGAGGCTA
CAGATTTCCCCCTGCAATACACTTTAACCTTCAGTGGAGATTCCCAGAAGCTTCCTGAGTTCCTGGTTCA
GCTGTATAGTTACATGAGAGTCAGAGGGCACCTGTATCCCACTGAAGCAGCCCTGGTGAGCTTTGTTGGC
AATTGCTTCTCAGGTAGGGCAGGATGGTGGTTCCAGCTCTTACTGGATATCCAAAGCCCCTTACTGGAGC
AATGTGAAAGTTTCATACCTGTGCTCCAGGATACTTTTGATAATCCAGAAAACATGAAAGATGCCAACCA
GTGCATCCATCAACTCTGCCAAGGGGAGGGTCATGTAGCAACCCACTTCCACCTCATTGCTCAAGAGCTG
AACTGGGATGAAAGCACTCTCTGGATCCAATTTCAAGAAGGTCTTGCCAGTTCTATACAAGATGAACTGT
CTCACACAAGCCCAGCCACCAACCTATCTGATCTCATCACTCAGTGCATCAGCCTGGAAGAGAAGCCTGA
TCCCAATCCATTAGGGAAAAGTTCCTCTGCAGAGGGAGATGGACCCGAGAGTCCACCAGCTGAAAACCAA
CCTATGCAGGCTGCAATCAACTGCCCACACATCAGTGAAGCTGAATGGGTCCGTTGGCACAAAGGCCGCT
TATGCCTCTACTGTGGTTATCCTGGTCATTTTGCCAGAGATTGCCCTGTCAAGCCTCATCAGGCCCTGCA
GGCGGGAAACATCCAGGCCTGCCAG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC223801 representing NM_152694
Red=Cloning site Green=Tags(s)

MVEDLAASYIVLKLENEIRQAQVQWLMEENAALQAQIPELQKSQAAKEYDLLRKSSEAKEPQKLPEHMNP
PAAWEAQKTPEFKEPQKPPEPQDLLPWEPPAAWELQEAPAAPESLAPPATRESQKPPMAHEIPTVLEGQG
PANTQDATIAQEPKNSEPQDPPNIEKPQEAPEYQETAAQLEFLELPPPQEPLEPSNAQEFLELSAAQESL
EGLIVVETSAASEFPQAPIGLEATDFPLQYTLTFSGDSQKLPEFLVQLYSYMRVRGHLYPTEAALVSFVG
NCFSGRAGWWFQLLLDIQSPLLEQCESFIPVLQDTFDNPENMKDANQCIHQLCQGEGHVATHFHLIAQEL
NWDESTLWIQFQEGLASSIQDELSHTSPATNLSDLITQCISLEEKPDPNPLGKSSSAEGDGPESPPAENQ
PMQAAINCPHISEAEWVRWHKGRLCLYCGYPGHFARDCPVKPHQALQAGNIQACQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_152694
ORF Size 1425 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_152694.3
RefSeq Size 2648 bp
RefSeq ORF 1428 bp
Locus ID 203430
UniProt ID Q8N8U3
Cytogenetics Xq21.1
MW 52.6 kDa
Summary This gene is a member of a family of gag-related retrotransposon genes. These genes appear to have lost the ability to retrotranspose; however, their open reading frames have remained intact, which may indicate that these genes have acquired new functions in the cell. provided by RefSeq, Nov 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_152694" in other vectors (4)
SKU Description Size Price
RC223801L3 Lenti-ORF clone of ZCCHC5 (Myc-DDK-tagged)-Human zinc finger, CCHC domain containing 5 (ZCCHC5) 10 ug
$757.00
RC223801L4 Lenti-ORF clone of ZCCHC5 (mGFP-tagged)-Human zinc finger, CCHC domain containing 5 (ZCCHC5) 10 ug
$757.00
RG223801 ZCCHC5 (tGFP-tagged) - Human zinc finger, CCHC domain containing 5 (ZCCHC5) 10 ug
$657.00
SC306484 ZCCHC5 (untagged)-Human zinc finger, CCHC domain containing 5 (ZCCHC5) 10 ug
$503.00

Plasmid Map for RC223801

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC223801
Circular map for RC223801

file-alt Citations

A retrotransposon gag-like-3 gene RTL3 and SOX-9 co-regulate the expression of COL2A1 in chondrocytes
Ball, Ansari, Ahmad et al
Connect Tissue Res (2020)
Cited by 6
AI Summary: OriGene products contributed to this study by providing the mouse Rtl3 gene knockout kit (Cat #KN519666) for CRISPR-Cas9-mediated deletion of Rtl3 in ATDC5 cells and Turbofectin (Cat# TF81005) as the transfection reagent for introducing gRNA and donor DNA.
Snippet: A mouse Rtl3 gene knockout kit was purchased from OriGene (Cat #KN519666) to perform CRISPR-Cas9 deletion in ATDC cells. In brief, Turbofectin (OriGene, Cat# TF81005) was used to transfect gRNA and donor DNA into ATDC5 cells in DMEM media
A neofunctionalized gene ZCCHC5 is expressed in cartilage and its downregulation inhibits COL2A1 expression and enhances the expression of MMP-13 in chondrocytes
Khan, Haqqi
Osteoarthritis and Cartilage (2018) 26, S131 DOI: 10.1016/j.joca.2018.02.284
AI Summary: OriGene products—specifically the human ZCCHC5 overexpression plasmid (RC223801) and the murine Zcchc5 plasmid (MR208781)—were used to manipulate ZCCHC5 expression in chondrocytes, enabling the study of its functional role in cartilage biology.
Snippet: siRNA mediated depletion of ZCCHC5 or overexpression of human ZCCHC5 in human chondrocytes (Origene, RC223801) and murine Zcchc5 mouse chondrocytes (Origene, MR208781) was used to study its role in chondrocyte function under pathological conditions
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products