OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BOK (NM_032515) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC222963
BOK (Myc-DDK-tagged)-Human BCL2-related ovarian killer (BOK)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA349258 Rabbit Polyclonal Anti-FGF9 Antibody
100 ul
$205.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "BOK or NM_032515"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol BOK
Synonyms BCL2L9; BOKL
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC222963 representing NM_032515
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGTGCTGCGGCGCTCCTCGGTCTTCGCCGCCGAGATCATGGACGCCTTTGACCGCTCGCCCACAG
ACAAGGAGCTGGTGGCCCAGGCCAAGGCGCTGGGCCGGGAGTACGTGCACGCGCGGCTGCTGCGCGCCGG
CCTCTCCTGGAGCGCGCCCGAGCGTGCCGCGCCGGTCCCGGGACGCCTGGCTGAGGTGTGCGCGGTGCTG
CTGCGCCTGGGCGATGAGCTGGAGATGATCCGGCCCAGCGTCTACCGCAACGTGGCGCGTCAGCTGCACA
TCTCCCTGCAGTCTGAGCCTGTGGTGACCGATGCGTTCCTGGCCGTGGCTGGCCACATCTTCTCTGCAGG
CATCACGTGGGGCAAGGTGGTGTCCCTGTATGCGGTGGCCGCGGGGCTGGCCGTGGACTGTGTGAGGCAG
GCCCAGCCTGCCATGGTCCACGCCCTCGTGGACTGCCTGGGGGAGTTCGTGCGCAAGACCCTGGCAACCT
GGCTGCGGAGACGCGGCGGATGGACTGATGTCCTCAAGTGTGTGGTCAGCACAGACCCTGGCCTCCGCTC
CCACTGGCTGGTGGCTGCACTCTGCAGCTTCGGCCGCTTCCTGAAGGCTGCCTTCTTCGTGCTGCTGCCA
GAGAGA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC222963 representing NM_032515
Red=Cloning site Green=Tags(s)

MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERAAPVPGRLAEVCAVL
LRLGDELEMIRPSVYRNVARQLHISLQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYAVAAGLAVDCVRQ
AQPAMVHALVDCLGEFVRKTLATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAALCSFGRFLKAAFFVLLP
ER

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_032515
ORF Size 636 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_032515.5
RefSeq Size 2617 bp
RefSeq ORF 639 bp
Locus ID 666
UniProt ID Q9UMX3, A0A024R4A8
Cytogenetics 2q37.3
Domains Bcl-2
Protein Families Druggable Genome
MW 23.1 kDa
Summary The protein encoded by this gene belongs to the BCL2 family, members of which form homo- or heterodimers, and act as anti- or proapoptotic regulators that are involved in a wide variety of cellular processes. Studies in rat show that this protein has restricted expression in reproductive tissues, interacts strongly with some antiapoptotic BCL2 proteins, not at all with proapoptotic BCL2 proteins, and induces apoptosis in transfected cells. Thus, this protein represents a proapoptotic member of the BCL2 family. provided by RefSeq, Sep 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_032515" in other vectors (6)
SKU Description Size Price
RC222963L1 Lenti ORF clone of Human BCL2-related ovarian killer (BOK), Myc-DDK-tagged 10 ug
$600.00
RC222963L2 Lenti ORF clone of Human BCL2-related ovarian killer (BOK), mGFP tagged 10 ug
$600.00
RC222963L3 Lenti ORF clone of Human BCL2-related ovarian killer (BOK), Myc-DDK-tagged 10 ug
$600.00
RC222963L4 Lenti ORF clone of Human BCL2-related ovarian killer (BOK), mGFP tagged 10 ug
$600.00
RG222963 BOK (tGFP-tagged) - Human BCL2-related ovarian killer (BOK) 10 ug
$489.00 $500.00
SC104435 BOK (untagged)-Human BCL2-related ovarian killer (BOK) 10 ug
$300.00

Plasmid Map for RC222963

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC222963
Circular map for RC222963

file-alt Citations

Role of B-Cell Lymphoma 2 Ovarian Killer (BOK) in Acute Toxicity of Human Lung Epithelial Cells Caused by Cadmium Chloride
Zhang, Ren, Zhou et al
Med. Sci. Monit. (2019) 25, 5356-5368 DOI: 10.12659/MSM.913706
AI Summary: OriGene's BOK-ORF plasmid (pCMV6-Entry vector) was used to generate BOK over-expressing human bronchial epithelial cells, enabling the study of BOK's role in cadmium chloride-induced toxicity.
Snippet: The BOK-ORF plasmid was purchased from Origene (Origene, USA), and its sequence is shown in Supplementary Figure 1. ORF cDNA was excised from the pCMV6-Entry vector using F-xbal and R-ecoR1 restriction enzymes and subcloned into a pCDH expression;;The BOK-ORF plasmid was purchased from Origene (Origene, USA), and its sequence is shown in Supplementary Figure 1. …
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products