OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TCN1 (NM_001062) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC222285
TCN1 (Myc-DDK-tagged)-Human transcobalamin I (vitamin B12 binding protein, R binder family) (TCN1)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA382381 TCN1 Rabbit polyclonal Antibody
100 ul
$410.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "TCN1 or NM_001062"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TCN1
Synonyms HC; TC-1; TC1; TCI
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC222285 representing NM_001062
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGACAGTCACACCAGCTGCCCCTAGTGGGGCTCTTACTGTTTTCTTTTATTCCAAGCCAACTATGCG
AGATTTGTGAGGTAAGTGAAGAAAACTACATCCGCCTAAAACCTCTGTTGAATACAATGATCCAGTCAAA
CTATAACAGGGGAACCAGCGCTGTCAATGTTGTGTTGTCCCTCAAACTTGTTGGAATCCAGATCCAAACC
CTGATGCAAAAGATGATCCAACAAATCAAATACAATGTGAAAAGCAGATTGTCAGATGTAAGCTCGGGAG
AGCTTGCCTTGATTATACTGGCTTTGGGAGTATGTCGTAACGCTGAGGAAAACTTAATATATGATTACCA
CCTGATCGACAAGCTAGAAAATAAATTCCAAGCAGAAATTGAAAATATGGAAGCACACAATGGCACTCCC
CTGACTAACTACTACCAGCTCAGCCTGGACGTTTTGGCCTTGTGTCTGTTCAATGGGAACTACTCAACCG
CCGAAGTTGTCAACCACTTCACTCCTGAAAATAAAAACTATTATTTTGGTAGCCAGTTCTCAGTAGATAC
TGGTGCAATGGCTGTCCTGGCTCTGACCTGTGTGAAGAAGAGTCTAATAAATGGGCAGATCAAAGCAGAT
GAAGGCAGTTTAAAGAACATCAGTATTTATACAAAGTCACTGGTAGAAAAGATTCTGTCTGAGAAAAAAG
AAAATGGTCTCATTGGAAACACATTTAGCACAGGAGAAGCCATGCAGGCCCTCTTTGTATCATCAGACTA
TTATAATGAAAATGACTGGAATTGCCAACAAACTCTGAATACAGTGCTCACGGAAATTTCTCAAGGAGCA
TTCAGTAATCCAAACGCTGCAGCCCAGGTCTTACCTGCCCTGATGGGAAAGACCTTCTTGGATATTAACA
AAGACTCTTCTTGCGTCTCTGCTTCAGGTAACTTCAACATCTCCGCTGATGAGCCTATAACTGTGACACC
TCCTGACTCACAATCATATATCTCCGTCAATTACTCTGTGAGAATCAATGAAACATATTTCACCAATGTC
ACTGTGCTAAATGGTTCTGTCTTCCTCAGTGTGATGGAGAAAGCCCAGAAAATGAATGATACTATATTTG
GTTTCACAATGGAGGAGCGCTCATGGGGGCCCTATATCACCTGTATTCAGGGCCTATGTGCCAACAATAA
TGACAGAACCTACTGGGAACTTCTGAGTGGAGGCGAACCACTGAGCCAAGGAGCTGGTAGTTACGTTGTC
CGCAATGGA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC222285 representing NM_001062
Red=Cloning site Green=Tags(s)

MRQSHQLPLVGLLLFSFIPSQLCEICEVSEENYIRLKPLLNTMIQSNYNRGTSAVNVVLSLKLVGIQIQT
LMQKMIQQIKYNVKSRLSDVSSGELALIILALGVCRNAEENLIYDYHLIDKLENKFQAEIENMEAHNGTP
LTNYYQLSLDVLALCLFNGNYSTAEVVNHFTPENKNYYFGSQFSVDTGAMAVLALTCVKKSLINGQIKAD
EGSLKNISIYTKSLVEKILSEKKENGLIGNTFSTGEAMQALFVSSDYYNENDWNCQQTLNTVLTEISQGA
FSNPNAAAQVLPALMGKTFLDINKDSSCVSASGNFNISADEPITVTPPDSQSYISVNYSVRINETYFTNV
TVLNGSVFLSVMEKAQKMNDTIFGFTMEERSWGPYITCIQGLCANNNDRTYWELLSGGEPLSQGAGSYVV
RNG

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001062
ORF Size 1269 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq Size 1576 bp
RefSeq ORF 1302 bp
Locus ID 6947
UniProt ID P20061
Cytogenetics 11q12.1
Protein Families Secreted Protein
MW 46.9 kDa
Summary This gene encodes a member of the vitamin B12-binding protein family. This family of proteins, alternatively referred to as R binders, is expressed in various tissues and secretions. This protein is a major constituent of secondary granules in neutrophils and facilitates the transport of cobalamin into cells. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001062" in other vectors (6)
SKU Description Size Price
RC222285L1 Lenti ORF clone of Human transcobalamin I (vitamin B12 binding protein, R binder family) (TCN1), Myc-DDK-tagged 10 ug
$757.00
RC222285L2 Lenti ORF clone of Human transcobalamin I (vitamin B12 binding protein, R binder family) (TCN1), mGFP tagged 10 ug
$757.00
RC222285L3 Lenti ORF clone of Human transcobalamin I (vitamin B12 binding protein, R binder family) (TCN1), Myc-DDK-tagged 10 ug
$757.00
RC222285L4 Lenti ORF clone of Human transcobalamin I (vitamin B12 binding protein, R binder family) (TCN1), mGFP tagged 10 ug
$757.00
RG222285 TCN1 (tGFP-tagged) - Human transcobalamin I (vitamin B12 binding protein, R binder family) (TCN1) 10 ug
$489.00 $657.00
SC302965 TCN1 (untagged)-Human transcobalamin I (vitamin B12 binding protein, R binder family) (TCN1) 10 ug
$457.00

Plasmid Map for RC222285

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC222285
Circular map for RC222285

file-alt Citations

Comparison of recombinant human haptocorrin expressed in human embryonic kidney cells and native haptocorrin
Furger, Fedosov, Lildballe et al
PLoS ONE (2012) 7 (5), e37421 DOI: 10.1371/journal.pone.0037421
Cited by 16
AI Summary: OriGene contributed the pCMV6-TCNI RC222285 Myc-DDK-tagged ORF clone of Homo sapiens transcobalamin I (TCN1) cDNA, which was used for the expression of recombinant human haptocorrin in this study.
Snippet: The cDNA for human HC (pCMV6-TCNI RC222285, Myc-DDK-tagged ORF clone of Homo sapiens transcobalamin I (TCN1) NCBI Reference Sequence: NM_001062.2, as transfection-ready DNA) purchased by Origene (Lab Force, Nunningen, Switzerland) was cloned into the
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products