OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

KCTD20 (NM_173562) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC221607
KCTD20 (Myc-DDK-tagged)-Human potassium channel tetramerisation domain containing 20 (KCTD20)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA355772 KCTD20 Antibody - C-terminal region
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "KCTD20 or NM_173562"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol KCTD20
Synonyms C6orf69; dJ108K11.3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC221607 representing NM_173562
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATGTTCACCGTGGCAGTGACAGTGACAGGTTATTGCGGCAGGAGGCCAGCTGCTTAGTGGATGATA
CTTTAGCTGTAGCCCAAGAAAAAGAAGCAAACAGCCTGGCTTCATCTGGTCCTCATAATCTTACTTATCC
TCTAGGTCCCAGGAATGAAGACCTCTCACTTGACTATGCCTCTCAGCCAGCAAATCTTCAGTTCCCTCAC
ATAATGCCCCTTGCTGAAGACATCAAAGGTTCTTGCTTCCAAAGTGGGAATAAACGGAACCATGAACCTT
TTATTGCTCCAGAAAGATTTGGAAACAGTAGTGTGGGCTTTGGCAGTAATTCCCATTCCCAAGCACCAGA
GAAAGTGACGCTTCTTGTAGATGGCACACGTTTTGTTGTGAATCCACAGATTTTCACTGCTCATCCGGAT
ACCATGCTGGGAAGGATGTTTGGACCAGGAAGAGAGTACAACTTCACTCGGCCCAATGAGAAGGGAGAGT
ATGAGATTGCTGAAGGCATCAGTGCAACTGTATTTCGCACAGTGCTGGATTATTACAAAACCGGTATCAT
CAATTGTCCTGATGGCATCTCTATCCCAGATCTTAGAGATACTTGTGATTATCTCTGCATTAATTTTGAC
TTCAACACTATCCGATGTCAAGATCTGAGTGCTTTACTCCATGAACTGTCTAATGACGGTGCTCATAAGC
AGTTTGATCACTACCTCGAAGAGCTCATCTTGCCCATCATGGTGGGCTGTGCCAAGAAAGGAGAACGAGA
GTGCCACATTGTTGTGCTGACGGATGAGGATTCTGTGGACTGGGATGAAGACCACCCTCCACCAATGGGG
GAGGAATATTCCCAAATTCTTTATAGCTCCAAGCTCTACAGATTCTTCAAATATATTGAGAATAGGGATG
TTGCAAAAACAGTGTTAAAGGAACGGGGCCTAAAAAACATTCGCATTGGAATTGAAGGTTACCCTACCTG
TAAAGAAAAAATTAAGAGAAGGCCTGGCGGCCGGTCTGAAGTCATCTATAATTATGTACAACGCCCCTTC
ATCCAGATGTCATGGGAAAAGGAAGAAGGGAAGAGTCGCCATGTGGATTTCCAGTGTGTTCGAAGCAAAT
CCCTCACGAATCTGGTAGCTGCTGGAGATGATGTCTTGGAGGACCAGGAGATATTAATGCATCACCCACC
CCAAGTGGATGAACTTGACCGGCTAAATGCCCCACTTTCTCAGATGGCTTCTAACGACTTTCAGGAT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC221607 representing NM_173562
Red=Cloning site Green=Tags(s)

MNVHRGSDSDRLLRQEASCLVDDTLAVAQEKEANSLASSGPHNLTYPLGPRNEDLSLDYASQPANLQFPH
IMPLAEDIKGSCFQSGNKRNHEPFIAPERFGNSSVGFGSNSHSQAPEKVTLLVDGTRFVVNPQIFTAHPD
TMLGRMFGPGREYNFTRPNEKGEYEIAEGISATVFRTVLDYYKTGIINCPDGISIPDLRDTCDYLCINFD
FNTIRCQDLSALLHELSNDGAHKQFDHYLEELILPIMVGCAKKGERECHIVVLTDEDSVDWDEDHPPPMG
EEYSQILYSSKLYRFFKYIENRDVAKTVLKERGLKNIRIGIEGYPTCKEKIKRRPGGRSEVIYNYVQRPF
IQMSWEKEEGKSRHVDFQCVRSKSLTNLVAAGDDVLEDQEILMHHPPQVDELDRLNAPLSQMASNDFQD

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_173562
ORF Size 1257 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_173562.5
RefSeq Size 5032 bp
RefSeq ORF 1260 bp
Locus ID 222658
UniProt ID Q7Z5Y7
Cytogenetics 6p21.31
Protein Families Druggable Genome, Ion Channels: Other
MW 47.3 kDa
Summary Promotes the phosphorylation of AKT family members.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_173562" in other vectors (6)
SKU Description Size Price
RC221607L1 Lenti ORF clone of Human potassium channel tetramerisation domain containing 20 (KCTD20), Myc-DDK-tagged 10 ug
$757.00
RC221607L2 Lenti ORF clone of Human potassium channel tetramerisation domain containing 20 (KCTD20), mGFP tagged 10 ug
$757.00
RC221607L3 Lenti ORF clone of Human potassium channel tetramerisation domain containing 20 (KCTD20), Myc-DDK-tagged 10 ug
$757.00
RC221607L4 Lenti ORF clone of Human potassium channel tetramerisation domain containing 20 (KCTD20), mGFP tagged 10 ug
$757.00
RG221607 KCTD20 (tGFP-tagged) - Human potassium channel tetramerisation domain containing 20 (KCTD20) 10 ug
$657.00
SC313384 KCTD20 (untagged)-Human potassium channel tetramerisation domain containing 20 (KCTD20) 10 ug
$503.00

Plasmid Map for RC221607

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC221607
Circular map for RC221607

file-alt Citations

Kctd20 promotes the development of non-small cell lung cancer through activating Fak/AKT pathway and predicts poor overall survival of patients
Zhang, Zhou, Cai et al
Mol. Carcinog. (2017)
AI Summary: OriGene products, specifically the pCMV6-ddk-myc and pCMV6-ddk-myc-Kctd20 plasmids, were used in this study to overexpress Kctd20 in non-small cell lung cancer cells, enabling the researchers to investigate its role in cancer development and signaling pathways.
Snippet: Experiments were repeated in triplicate. Plasmid transfection and small interfering RNA treatment Plasmids pCMV6-ddk-myc and pCMV6-ddk-myc-Kctd20 were purchased from Origene (Rockville, MD, USA). Kctd20-siRNA (sc-95124) and NC-siRNA (sc-37007) were ... All 2 versions Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products