OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MSL1 (NM_001012241) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC221031
MSL1 (Myc-DDK-tagged)-Human male-specific lethal 1 homolog (Drosophila) (MSL1)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA358705 MSL1 Antibody - middle region
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "MSL1 or NM_001012241"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MSL1
Synonyms MSL-1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC221031 representing NM_001012241
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAAGGCGGATGCAGCTGGTAAAGAAGGATAACGAGAAAGAAAGGCACAAGCTGTTTCAGGGCTATG
AAACTGAAGAGAGAGAGGAAACAGAGCTATCTGAGAAAATTAAACTGGAGTGCCAGCCGGAGCTTTCCGA
GACATCCCAGACTCTGCCTCCCAAGCCCTTCTCATGTGGGCGGAGTGGAAAGGGACATAAAAGGAAATCC
CCATTTGGAAGTACAGAAAGAAAGACTCCTGTTAAAAAGCTGGCTCCTGAATTTTCAAAAGTCAAAACAA
AAACTCCTAAGCACTCTCCTATTAAAGAGGAACCCTGTGGTTCCTTATCTGAAACTGTTTGTAAACGTGA
ATTGAGGAGCCAAGAAACCCCAGAAAAGCCCCGGTCTTCAGTGGACACCCCACCAAGACTCTCCACTCCC
CAAAAGGGACCCAGCACCCATCCCAAGGAGAAAGCCTTCTCAAGTGAGATAGAAGATTTGCCGTACCTTT
CCACCACAGAAATGTATTTGTGTCGTTGGCACCAGCCTCCCCCATCACCGTTACCATTACGGGAATCCTC
TCCAAAGAAGGAGGAGACTGTAGCAAGGTGTCTGATGCCATCAAGTGTTGCAGGAGAAACTTCAGTCTTG
GCTGTTCCTTCTTGGAGGGACCACTCAGTAGAGCCTCTAAGGGACCCAAATCCTTCAGACCTTTTGGAGA
ACCTGGATGACAGTGTGTTTTCGAAGCGGCATGCAAAACTGGAGCTGGATGAGAAGAGAAGGAAAAGATG
GGATATTCAGAGGATCAGGGAACAAAGAATTTTACAGCGACTGCAGCTCAGAATGTATAAAAAGAAAGGA
ATTCAGGAATCTGAGCCTGAGGTTACCTCATTTTTCCCTGAGCCAGATGATGTTGAAAGTTTGATGATTA
CCCCCTTCTTGCCTGTTGTAGCATTTGGACGACCATTACCAAAATTAACTCCACAGAATTTTGAGCTACC
CTGGTTGGATGAGCGTAGCCGATGCAGATTGGAGATCCAGAAGAAGCAAACACCTCACCGGACGTGTAGG
AAA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC221031 representing NM_001012241
Red=Cloning site Green=Tags(s)

MERRMQLVKKDNEKERHKLFQGYETEEREETELSEKIKLECQPELSETSQTLPPKPFSCGRSGKGHKRKS
PFGSTERKTPVKKLAPEFSKVKTKTPKHSPIKEEPCGSLSETVCKRELRSQETPEKPRSSVDTPPRLSTP
QKGPSTHPKEKAFSSEIEDLPYLSTTEMYLCRWHQPPPSPLPLRESSPKKEETVARCLMPSSVAGETSVL
AVPSWRDHSVEPLRDPNPSDLLENLDDSVFSKRHAKLELDEKRRKRWDIQRIREQRILQRLQLRMYKKKG
IQESEPEVTSFFPEPDDVESLMITPFLPVVAFGRPLPKLTPQNFELPWLDERSRCRLEIQKKQTPHRTCR
K

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001012241
ORF Size 1053 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001012241.2
RefSeq Size 3834 bp
RefSeq ORF 1056 bp
Locus ID 339287
UniProt ID Q68DK7, B3KWR7, Q68DK7-3
Cytogenetics 17q21.1
MW 40.6 kDa
Summary Component of histone acetyltransferase complex responsible for the majority of histone H4 acetylation at 'Lys-16' (H4K16ac) which is implicated in the formation of higher-order chromatin structure (PubMed:16227571). Greatly enhances MSL2 E3 ubiquitin ligase activity, promoting monoubiquitination of histone H2B at 'Lys-34' (H2BK34Ub) (PubMed:21726816). This modification in turn stimulates histone H3 methylation at 'Lys-4' (H3K4me) and 'Lys-79' (H3K79me) and leads to gene activation, including that of HOXA9 and MEIS1 (PubMed:21726816). In the MSL complex, acts as a scaffold to tether MSL3 and KAT8 together for enzymatic activity regulation (PubMed:22547026).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001012241" in other vectors (6)
SKU Description Size Price
RC221031L1 Lenti ORF clone of Human male-specific lethal 1 homolog (Drosophila) (MSL1), Myc-DDK-tagged 10 ug
$757.00
RC221031L2 Lenti ORF clone of Human male-specific lethal 1 homolog (Drosophila) (MSL1), mGFP tagged 10 ug
$757.00
RC221031L3 Lenti ORF clone of Human male-specific lethal 1 homolog (Drosophila) (MSL1), Myc-DDK-tagged 10 ug
$757.00
RC221031L4 Lenti ORF clone of Human male-specific lethal 1 homolog (Drosophila) (MSL1), mGFP tagged 10 ug
$757.00
RG221031 MSL1 (tGFP-tagged) - Human male-specific lethal 1 homolog (Drosophila) (MSL1) 10 ug
$657.00
SC316507 MSL1 (untagged)-Human male-specific lethal 1 homolog (Drosophila) (MSL1) 10 ug
$457.00

Plasmid Map for RC221031

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC221031
Circular map for RC221031

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products