OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ZCWPW2 (NM_001040432) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC220757
ZCWPW2 (Myc-DDK-tagged)-Human zinc finger, CW type with PWWP domain 2 (ZCWPW2)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA809589 ZCWPW2 mouse monoclonal antibody,clone OTI10A12 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "ZCWPW2 or NM_001040432"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ZCWPW2
Synonyms ZCW2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC220757 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATAAAGAAAAATTGGATGTTAAGATTGAATATTGTAACTATGCAATGGATTCCTCAGTGGAAAACA
TGTATGTAAACAAAGTGTGGGTTCAATGTGAGAATGAAAATTGTTTGAAATGGAGATTGTTATCAAGTGA
GGATTCAGCCAAGGTTGATCATGATGAACCATGGTACTGCTTCATGAACACTGATTCAAGATATAATAAC
TGCTCAATTTCTGAAGAAGACTTCCCTGAAGAGTCTCAGCTTCATCAGTGTGGATTTAAGATTGTCTATT
CACAGCTCCCTCTTGGAAGCCTGGTTTTGGTAAAATTACAGAATTGGCCAAGTTGGCCAGGAATACTTTG
CCCTGACCGTTTTAAAGGGAAATATGTAACTTATGACCCGGATGGAAATGTTGAAGAGTATCACATAGAA
TTCCTGGGCGATCCCCATTCAAGATCATGGATAAAGGCAACATTCGTTGGACATTATAGTATCACATTAA
AGCCAGAAAAGTGTAAGAATAAAAAGAAGTGGTATAAAAGTGCACTACAAGAAGCATGTCTACTCTATGG
ATATTCTCATGAGCAAAGACTGGAAATGTGCTGCCTATCAAAACTACAAGATAAATCCGAAACACATGAC
AAAGTTGCTGCACTGGTCAAGAAAAGGAAGCAGACTTCTAAAAATAATATTGAAAAGAAGAAGCCCAAAT
TTAGAAAAAGGAAAAGGAAAGCAATTTTAAAATGCTCTTTTGAAAATGTTTATTCTGATGATGCCTTATC
AAAGGAGAACAGGGTTGTCTGTGAGACGGAAGTTTTACTAAAAGAGCTGGAGCAAATGCTGCAGCAAGCA
CTGCAACCCACAGCCACACCTGATGAATCAGAAGAAGGACATGGAGAGGAAATAAATATGGGAGAAAAGT
TATCTAAATGCAGCCCAGAAGCTCCTGCAGGCAGTCTGTTTGAAAACCACTATGAAGAGGACTATCTTGT
AATTGATGGGATAAAATTAAAAGCTGGAGAATGTATTGAGGATATAACTAATAAATTTAAAGAAATAGAT
GCTTTGATGTCTGAGTTT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC220757 protein sequence
Red=Cloning site Green=Tags(s)

MDKEKLDVKIEYCNYAMDSSVENMYVNKVWVQCENENCLKWRLLSSEDSAKVDHDEPWYCFMNTDSRYNN
CSISEEDFPEESQLHQCGFKIVYSQLPLGSLVLVKLQNWPSWPGILCPDRFKGKYVTYDPDGNVEEYHIE
FLGDPHSRSWIKATFVGHYSITLKPEKCKNKKKWYKSALQEACLLYGYSHEQRLEMCCLSKLQDKSETHD
KVAALVKKRKQTSKNNIEKKKPKFRKRKRKAILKCSFENVYSDDALSKENRVVCETEVLLKELEQMLQQA
LQPTATPDESEEGHGEEINMGEKLSKCSPEAPAGSLFENHYEEDYLVIDGIKLKAGECIEDITNKFKEID
ALMSEF

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001040432
ORF Size 1068 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001040432.4
RefSeq Size 1752 bp
RefSeq ORF 1071 bp
Locus ID 152098
UniProt ID Q504Y3
Cytogenetics 3p24.1
MW 41.4 kDa
Summary Histone methylation reader which binds to non-methylated (H3K4me0), monomethylated (H3K4me1), dimethylated (H3K4me2) and trimethylated (H3K4me3) 'Lys-4' on histone H3 (PubMed:26933034). The order of binding preference is H3K4me3 > H3K4me2 > H3K4me1 > H3K4me0 (PubMed:26933034).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001040432" in other vectors (4)
SKU Description Size Price
RC220757L3 Lenti ORF clone of Human zinc finger, CW type with PWWP domain 2 (ZCWPW2), Myc-DDK-tagged 10 ug
$757.00
RC220757L4 Lenti ORF clone of Human zinc finger, CW type with PWWP domain 2 (ZCWPW2), mGFP tagged 10 ug
$757.00
RG220757 ZCWPW2 (tGFP-tagged) - Human zinc finger, CW type with PWWP domain 2 (ZCWPW2) 10 ug
$657.00
SC310707 ZCWPW2 (untagged)-Human zinc finger, CW type with PWWP domain 2 (ZCWPW2) 10 ug
$503.00

Plasmid Map for RC220757

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC220757
Circular map for RC220757

file-alt Citations

ZCWPW1 is recruited to recombination hotspots by PRDM9 and is essential for meiotic double strand break repair
Wells, Bitoun, Moralli et al
Elife (2020) 9 DOI: 10.7554/eLife.53392
AI Summary: In this study, OriGene's Zcwpw1 cDNA clone (MR209824) was used to express ZCWPW1 protein in human cells, enabling the authors to investigate its recruitment to PRDM9 binding sites and its essential role in meiotic double-strand break repair.
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products