OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RASSF6 (NM_201431) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC218087
RASSF6 (Myc-DDK-tagged)-Human Ras association (RalGDS/AF-6) domain family member 6 (RASSF6), transcript variant 2
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA303342 Goat Polyclonal Antibody against RASSF6
100 ug
$565.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "RASSF6 or NM_201431"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RASSF6
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC218087 representing NM_201431
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTCTGGGAGGAGACAGGCGCCGCCCCTGCGCCCGCGCGGGCCTCGGACCTCCCCTACAGGATATCCT
CAGACCATCTCAAAAAGGAGGAAAAGATGACTATGATGGCTCACCAGTACCCCTCTTGGATCTTCATTAA
TGAGAAGACATTCATAACCAGGGAACAACTTAATTCTTTATTGAAGACCTATAACATTTTTTATGAGAAC
CAGAAAAATCTGCATATTTTATATGGAGAGACTGAAGATGGCAAACTAATTGTTGAAGGAATGCTGGACA
TTTTCTGGGGAGTAAAACGACCTATACAGCTAAAAATACAAGATGAGAAGCCATTCTCTTCTTTTACTAG
TATGAAGTCATCAGACGTCTTCTCCAGCAAAGGAATGACACGCTGGGGGGAATTTGACGATCTCTATCGT
ATTAGTGAGCTGGACAGGACCCAGATTCCTATGTCTGAAAAAAGGAATTCCCAGGAAGACTATTTATCTT
ATCACAGCAACACCCTGAAGCCACATGCAAAGGATGAACCAGACTCCCCAGTGCTCTATAGAACCATGAG
TGAAGCAGCTCTGGTGAGAAAAAGGATGAAGCCTCTGATGATGGACAGAAAAGAAAGACAGAAAAATAGA
GCCTCTATTAATGGACACTTCTATAACCATGAAACATCAATTTTCATTCCAGCCTTTGAATCAGAAACTA
AGGTCAGAGTAAACAGTAACATGAGAACTGAAGAAGTAATAAAGCAACTTCTCCAAAAATTTAAGATTGA
AAATAGTCCCCAGGATTTTGCTCTTCACATTATTTTTGCAACAGGAGAACAAAGACGACTAAAGAAGACA
GACATTCCGCTACTGCAGAGGCTCCTACAGGGACCTTCTGAAAAGAATGCTCGCATTTTCCTCATGGATA
AAGATGCAGAAGAAATTAGCAGTGATGTGGCTCAGTACATTAACTTTCACTTTTCTCTCTTGGAATCCAT
TCTTCAAAGATTAAATGAAGAAGAGAAAAGAGAGATTCAAAGAATAGTAACAAAATTCAATAAAGAAAAG
GCGATTATACTGAAATGTCTTCAAAATAAACTAGTAATAAAAACAGAGACAACAGTT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC218087 representing NM_201431
Red=Cloning site Green=Tags(s)

MLWEETGAAPAPARASDLPYRISSDHLKKEEKMTMMAHQYPSWIFINEKTFITREQLNSLLKTYNIFYEN
QKNLHILYGETEDGKLIVEGMLDIFWGVKRPIQLKIQDEKPFSSFTSMKSSDVFSSKGMTRWGEFDDLYR
ISELDRTQIPMSEKRNSQEDYLSYHSNTLKPHAKDEPDSPVLYRTMSEAALVRKRMKPLMMDRKERQKNR
ASINGHFYNHETSIFIPAFESETKVRVNSNMRTEEVIKQLLQKFKIENSPQDFALHIIFATGEQRRLKKT
DIPLLQRLLQGPSEKNARIFLMDKDAEEISSDVAQYINFHFSLLESILQRLNEEEKREIQRIVTKFNKEK
AIILKCLQNKLVIKTETTV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_201431
ORF Size 1107 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_201431.2, NP_958834.1
RefSeq Size 4323 bp
RefSeq ORF 1110 bp
Locus ID 166824
UniProt ID Q6ZTQ3
Cytogenetics 4q13.3
MW 43.2 kDa
Summary This gene encodes a member of the Ras-association domain family (RASSF). Members of this family form the core of a highly conserved tumor suppressor network, the Salvador-Warts-Hippo (SWH) pathway. The protein encoded by this gene is a Ras effector protein that induces apoptosis. A genomic region containing this gene has been linked to susceptibility to viral bronchiolitis. Alternative splicing results in multiple transcript variants and protein isoforms. provided by RefSeq, Jul 2012
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_201431" in other vectors (4)
SKU Description Size Price
RC218087L3 Lenti ORF clone of Human Ras association (RalGDS/AF-6) domain family member 6 (RASSF6), transcript variant 2, Myc-DDK-tagged 10 ug
$757.00
RC218087L4 Lenti ORF clone of Human Ras association (RalGDS/AF-6) domain family member 6 (RASSF6), transcript variant 2, mGFP tagged 10 ug
$757.00
RG218087 RASSF6 (tGFP-tagged) - Human Ras association (RalGDS/AF-6) domain family member 6 (RASSF6), transcript variant 2 10 ug
$657.00
SC308025 RASSF6 (untagged)-Human Ras association (RalGDS/AF-6) domain family member 6 (RASSF6), transcript variant 2 10 ug
$503.00

Plasmid Map for RC218087

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC218087
Circular map for RC218087

file-alt Citations

RASSF6 Is Downregulated In Human Bladder Cancers And Regulates Doxorubicin Sensitivity And Mitochondrial Membrane Potential Via The Hippo Signaling Pathway
Tan, Bian, Wu et al
Onco Targets Ther (2019) 12, 9189-9200 DOI: 10.2147/OTT.S217041
AI Summary: OriGene contributed to this study by providing the RASSF6 plasmid, which was used to overexpress RASSF6 in bladder cancer cell lines to investigate its role in cell proliferation, invasion, doxorubicin sensitivity, and mitochondrial membrane potential.
Snippet: …RASSF6 plasmid was purchased from Origene (Origene, Rockville, USA) and transfected into cells using Lipofectamine 3000 (Invitrogen, USA). RASSF6 siRNA target sequence was: GACCCAGAUUCCUAUGUCU. …
FigureFigureFigure
Downregulation of RASSF6 promotes breast cancer growth and chemoresistance through regulation of Hippo signaling
He, Zhao, Jin et al
Biochem. Biophys. Res. Commun. (2018)
AI Summary: OriGene contributed to this study by providing the pCMV6-RASSF6 plasmid and Empty vector (EV), which were used to manipulate RASSF6 expression in breast cancer cell lines to investigate its role in cancer growth and chemoresistance.
Snippet: Manassas, USA). Cells were cultured in DMEM (Gibco, USA) with 10% fetal bovine serum (Invitrogen, Carlsbad, CA, USA). pCMV6-RASSF6 plasmid and Empty vector (EV) were obtained from Origene (Origene, USA). RASSF6 target
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products