OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IL24 (NM_006850) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RC216502
IL24 (Myc-DDK-tagged)-Human interleukin 24 (IL24), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA809390 IL24 mouse monoclonal antibody,clone OTI3C5 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "IL24 or NM_006850"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol IL24
Synonyms C49A; FISP; IL10B; MDA7; MOB5; ST16
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>NM_006850 ORF sequence, RC216502 may differ due to SNPs.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGAATTTTCAACAGAGGCTGCAAAGCCTGTGGACTTTAGCCAGACCCTTCTGCCCTCCTTTGCTGGCG
ACAGCCTCTCAAATGCAGATGGTTGTGCTCCCTTGCCTGGGTTTTACCCTGCTTCTCTGGAGCCAGGTA
TCAGGGGCCCAGGGCCAAGAATTCCACTTTGGGCCCTGCCAAGTGAAGGGGGTTGTTCCCCAGAAACTG
TGGGAAGCCTTCTGGGCTGTGAAAGACACTATGCAAGCTCAGGATAACATCACGAGTGCCCGGCTGCTG
CAGCAGGAGGTTCTGCAGAACGTCTCGGATGCTGAGAGCTGTTACCTTGTCCACACCCTGCTGGAGTTC
TACTTGAAAACTGTTTTCAAAAACTACCACAATAGAACAGTTGAAGTCAGGACTCTGAAGTCATTCTCT
ACTCTGGCCAACAACTTTGTTCTCATCGTGTCACAACTGCAACCCAGTCAAGAAAATGAGATGTTTTCC
ATCAGAGACAGTGCACACAGGCGGTTTCTGCTATTCCGGAGAGCATTCAAACAGTTGGACGTAGAAGCA
GCTCTGACCAAAGCCCTTGGGGAAGTGGACATTCTTCTGACCTGGATGCAGAAATTCTACAAGCTC
ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGAT
TACAAGGATGACGACGATAAGGTTTAAACGGCCGGC
Protein Sequence
>Peptide sequence encoded by RC216502
Blue=ORF Red=Cloning site Green=Tag(s)

MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKL
WEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFS
TLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL
myc-FLAG tag

Recombinant protein using RC216502 also available, TP316502M
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_006850
ORF Size 618 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006850.3, NP_006841.1
RefSeq Size 1976 bp
RefSeq ORF 621 bp
Locus ID 11009
UniProt ID Q13007
Cytogenetics 1q32.1
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway
MW 23.8 kDa
Summary This gene encodes a member of the IL10 family of cytokines. It was identified as a gene induced during terminal differentiation in melanoma cells. The protein encoded by this gene can induce apoptosis selectively in various cancer cells. Overexpression of this gene leads to elevated expression of several GADD family genes, which correlates with the induction of apoptosis. The phosphorylation of mitogen-activated protein kinase 14 (MAPK7/P38), and heat shock 27kDa protein 1 (HSPB2/HSP27) are found to be induced by this gene in melanoma cells, but not in normal immortal melanocytes. Alternatively spliced transcript variants encoding distinct isoforms have been reported. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_006850" in other vectors (6)
SKU Description Size Price
RC216502L1 Lenti ORF clone of Human interleukin 24 (IL24), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC216502L2 Lenti ORF clone of Human interleukin 24 (IL24), transcript variant 1, mGFP tagged 10 ug
$600.00
RC216502L3 Lenti ORF clone of Human interleukin 24 (IL24), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC216502L4 Lenti ORF clone of Human interleukin 24 (IL24), transcript variant 1, mGFP tagged 10 ug
$600.00
RG216502 IL24 (tGFP-tagged) - Human interleukin 24 (IL24), transcript variant 1 10 ug
$500.00
SC303831 IL24 (untagged)-Human interleukin 24 (IL24), transcript variant 1 10 ug
$330.00

Plasmid Map for RC216502

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC216502
Circular map for RC216502

file-alt Citations

Bis-indole derived nuclear receptor 4A1 (NR4A1) antagonists inhibit TGFβ-induced invasion of embryonal rhabdomyosarcoma cells
Shrestha, Mohankumar, Safe
American journal of cancer research (2020) 10 (8), 2495-2509
AI Summary: OriGene's human IL-24 cDNA clone in a pCMV-6 plasmid was used for overexpression studies to investigate the role of IL-24 in inhibiting TGFβ-induced invasion of embryonal rhabdomyosarcoma cells.
Snippet: Centennial, CO). Lipofectamine 2000 was obtained from Invitrogen (Carlsbad, CA) and human IL-24 cDNA clone in a pCMV-6 plasmid was purchased from Origene (Rockville, MD). siRNA interference/overexpression assay. RD or
Interleukin-24 (IL-24) Is Suppressed By PAX3-FOXO1 and Is A Novel Therapy For Rhabdomyosarcoma
Lacey, Hedrick, Cheng et al
Mol. Cancer Ther. (2018) 17 (12), 2756-2766 DOI: 10.1158/1535-7163.MCT-18-0118
AI Summary: In this study, OriGene's human IL-24 cDNA clone in a pCMV-6 vector was used to overexpress IL-24 and investigate its tumor-suppressing effects in rhabdomyosarcoma models.
Snippet: (Danvers, MA). The human IL-24 cDNA clone in a pCMV-6 vector was purchased from Origene (Rockville, MD);the HDAC5-flag expression plasmid was obtained from on September 24, 2018. 2018 American Association for Cancer Research
Crystal Structure of the Labile Complex of IL-24 with the Extracellular Domains of IL-22R1 and IL-20R2
Lubkowski, Sonmez, Smirnov et al
J. Immunol. (2018) 201 (7), 2082-2093 DOI: 10.4049/jimmunol.1800726
AI Summary: OriGene products contributed to this study by providing cDNA samples for IL-24 (cat. no. RC216502) and IL-20R1, which were used to construct plasmids for protein expression in Drosophila S2 cells for structural analysis.
Snippet: Construction of plasmids for expression in Drosophila S2 cells DNA sequences encoding proteins of interest were amplified from the cDNA samples purchased from OriGene (www.origene.com). They in- cluded IL-24 (cat. no. RC216502), IL-20R1 (cat. no
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products