OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PPHLN1 (NM_201515) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC216262
PPHLN1 (Myc-DDK-tagged)-Human periphilin 1 (PPHLN1), transcript variant 2
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA319929 Rabbit Polyclonal Periphilin Antibody
100 ug
$640.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "PPHLN1 or NM_201515"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PPHLN1
Synonyms CR; HSPC206; HSPC232
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC216262 representing NM_201515
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTTACAGAAGAGACGAAATGTGGTCTGAGGGACGATATGAATATGAAAGAATTCCGAGAGAACGAG
CACCTCCTCGAAGTCATCCCAGTGATGGCTACAATAGACTAGTTAATATTGTGCCAAAGAAACCACCACT
GCTAGACAGACCTGGTGAAGGAAGCTACAATAGATATTACAGTCATGTTGATTACCGAGACTATGACGAG
GGCCGCAGTTTTTCTCATGATCGAAGAAGTGGTCCACCTCACAGAGGAGATGAATCTGGTTATAGATGGA
CAAGAGACGATCATTCTGCAAGCAGGCAACCTGAATACAGGGACATGAGAGATGGCTTTAGAAGAAAAAG
TTTCTACTCTTCCCATTATGCGAGAGAGCGGTCTCCTTATAAAAGGGACAATACTTTTTTCAGAGAATCA
CCTGTTGGCCGAAAGGATTCTCCACACAGCAGATCTGGTTCCAGTGTCAGTAGCAGAAGCTACTCTCCAG
AAAGGAGCAAATCATACTCTTTCCATCAGTCTCAACATAGAAAGTCCGTGCGTCCTGGTGCCTCCTACAA
ACGGCAGAATGAAGGAAATCCTGAAAGAGATAAAGAGAGGCCTGTCCAGTCTTTGAAAACATCAAGAGAT
ACTTCACCCTCAAGTGGTTCAGCAGTTTCTTCATCAAAGGTGTTAGACAAACCCAGTAGGCTAACTGAAA
AGGAACTTGCTGAGGCTGCAAGCAAGTGGGCTGCTGAAAAGCTAGAGAAATCAGATGAAAGTAACTTGCC
TGAAATTTCTGAGTATGAGGCGGGATCCACAGCACCATTGTTTACTGACCAGCCAGAGGAACCTGAGTCA
AACACAACACATGGGATAGAATTATTTGAAGATAGTCAGCTAACCACTCGCTCTAAAGCAATAGCATCAA
AAACCAAAGAGATTGAACAGGTTTACCGACAAGACTGTGAAACTTTCGGGATGGTGGTGAAAATGCTGAT
TGAAAAAGATCCTTCATTAGAAAAGTCTATACAGTTTGCATTGAGGCAGAATTTACATGAAATAGGTGAG
CGGTGTGTTGAAGAACTCAAGCATTTCATTGCAGAGTATGATACTTCCACTCAAGATTTTGGAGAGCCTT
TT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC216262 representing NM_201515
Red=Cloning site Green=Tags(s)

MAYRRDEMWSEGRYEYERIPRERAPPRSHPSDGYNRLVNIVPKKPPLLDRPGEGSYNRYYSHVDYRDYDE
GRSFSHDRRSGPPHRGDESGYRWTRDDHSASRQPEYRDMRDGFRRKSFYSSHYARERSPYKRDNTFFRES
PVGRKDSPHSRSGSSVSSRSYSPERSKSYSFHQSQHRKSVRPGASYKRQNEGNPERDKERPVQSLKTSRD
TSPSSGSAVSSSKVLDKPSRLTEKELAEAASKWAAEKLEKSDESNLPEISEYEAGSTAPLFTDQPEEPES
NTTHGIELFEDSQLTTRSKAIASKTKEIEQVYRQDCETFGMVVKMLIEKDPSLEKSIQFALRQNLHEIGE
RCVEELKHFIAEYDTSTQDFGEPF

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_201515
ORF Size 1122 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_201515.1, NP_958923.1
RefSeq Size 1720 bp
RefSeq ORF 1125 bp
Locus ID 51535
UniProt ID Q8NEY8
Cytogenetics 12q12
MW 43.2 kDa
Summary The protein encoded by this gene is one of the several proteins that become sequentially incorporated into the cornified cell envelope during the terminal differentiation of keratinocyte at the outer layers of epidermis. This protein interacts with periplakin, which is known as a precursor of the cornified cell envelope. The cellular localization pattern and insolubility of this protein suggest that it may play a role in epithelial differentiation and contribute to epidermal integrity and barrier formation. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_201515" in other vectors (4)
SKU Description Size Price
RC216262L3 Lenti ORF clone of Human periphilin 1 (PPHLN1), transcript variant 2, Myc-DDK-tagged 10 ug
$757.00
RC216262L4 Lenti ORF clone of Human periphilin 1 (PPHLN1), transcript variant 2, mGFP tagged 10 ug
$757.00
RG216262 PPHLN1 (tGFP-tagged) - Human periphilin 1 (PPHLN1), transcript variant 2 10 ug
$657.00
SC308038 PPHLN1 (untagged)-Human periphilin 1 (PPHLN1), transcript variant 2 10 ug
$503.00

Plasmid Map for RC216262

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC216262
Circular map for RC216262

file-alt Citations

Oncogenic fusion protein FGFR2-PPHLN1: Requirements for biological activation, and efficacy of inhibitors
Li, Meyer, Peiris et al
Transl Oncol (2020) 13 (12), 100853 DOI: 10.1016/j.tranon.2020.100853
Cited by 3
AI Summary: OriGene’s myc-tagged PPHLN1 gene (clone RC216262) was used to generate key fusion protein constructs, enabling the study of FGFR2-PPHLN1’s role in oncogenic signaling and inhibitor response in intrahepatic cholangiocarcinoma.
Snippet: … Furthermore, we examined the effects of several inhibitors on the activity of FGFR2-PPHLN1. Materials and methods FGFR2-PPHLN1 constructs The myc-tagged PPHLN1 gene (OriGene Technologies, Inc., clone RC216262) was subcloned into pcDNA3. …FGFR2-PPHLN1 constructs. The myc-tagged PPHLN1 gene (OriGene Technologies, Inc., clone RC216262) was subcloned into pcDNA3. …
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products