OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SIVA (SIVA1) (NM_006427) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC215680
SIVA1 (Myc-DDK-tagged)-Human SIVA1, apoptosis-inducing factor (SIVA1), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA506830 SIVA1 mouse monoclonal antibody, clone OTI2F8 (formerly 2F8) 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "SIVA or NM_006427"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SIVA
Synonyms CD27BP; SIVA; Siva-1; Siva-2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC215680 representing NM_006427
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCAAGCGGAGCTGCCCCTTCGCGGACGTGGCCCCGCTACAGCTCAAGGTCCGCGTGAGCCAGAGGG
AGTTGAGCCGCGGCGTGTGCGCCGAGCGCTACTCGCAGGAGGTCTTCGAGAAGACCAAGCGACTCCTGTT
CCTCGGGGCCCAGGCCTACCTGGACCACGTGTGGGATGAAGGCTGTGCCGTCGTTCACCTGCCAGAGTCC
CCAAAGCCTGGCCCTACAGGGGCCCCGAGGGCTGCACGTGGGCAGATGCTGATTGGACCAGACGGCCGCC
TGATCAGGAGCCTTGGGCAGGCCTCCGAAGCTGACCCATCTGGGGTAGCGTCCATTGCCTGTTCCTCATG
CGTGCGAGCCGTGGATGGGAAGGCGGTCTGCGGTCAGTGTGAGCGAGCCCTGTGCGGGCAGTGTGTGCGC
ACCTGCTGGGGCTGCGGCTCCGTGGCCTGTACCCTGTGTGGCCTCGTGGACTGCAGTGACATGTACGAGA
AAGTGCTGTGCACCAGCTGTGCCATGTTCGAGACC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC215680 representing NM_006427
Red=Cloning site Green=Tags(s)

MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFEKTKRLLFLGAQAYLDHVWDEGCAVVHLPES
PKPGPTGAPRAARGQMLIGPDGRLIRSLGQASEADPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVR
TCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_006427
ORF Size 525 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006427.4
RefSeq Size 751 bp
RefSeq ORF 528 bp
Locus ID 10572
UniProt ID O15304
Cytogenetics 14q32.33
Protein Families Druggable Genome
MW 18.5 kDa
Summary This gene encodes an E3 ubiquitin ligase that regulates cell cycle progression, cell proliferation and apoptosis. The N-terminus of this protein binds to the cytoplasmic tail of the CD27 antigen, a member of the tumor necrosis factor receptor (TNFR) superfamily. In response to UV radiation-induced DNA damage, this protein has been shown to mediate the ubiquitination of proliferating cell nuclear antigen (PCNA), an important step in translesion DNA synthesis. provided by RefSeq, Sep 2018
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_006427" in other vectors (6)
SKU Description Size Price
RC215680L1 Lenti ORF clone of Human SIVA1, apoptosis-inducing factor (SIVA1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC215680L2 Lenti ORF clone of Human SIVA1, apoptosis-inducing factor (SIVA1), transcript variant 1, mGFP tagged 10 ug
$600.00
RC215680L3 Lenti ORF clone of Human SIVA1, apoptosis-inducing factor (SIVA1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC215680L4 Lenti ORF clone of Human SIVA1, apoptosis-inducing factor (SIVA1), transcript variant 1, mGFP tagged 10 ug
$600.00
RG215680 SIVA1 (tGFP-tagged) - Human SIVA1, apoptosis-inducing factor (SIVA1), transcript variant 1 10 ug
$489.00 $500.00
SC110170 SIVA1 (untagged)-Human SIVA1, apoptosis-inducing factor (SIVA1), transcript variant 1 10 ug
$300.00

Plasmid Map for RC215680

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC215680
Circular map for RC215680

file-alt Citations

Plumbagin inhibits proliferation and induces apoptosis of hepatocellular carcinoma by downregulating the expression of SIVA
Li, Lv, Chen et al
Drug Des Devel Ther (2019) 13, 1289-1300 DOI: 10.2147/DDDT.S200610
AI Summary: OriGene’s SIVA (NM_006427) Human Tagged ORF Clone was used in this study to overexpress the SIVA gene in liver cancer cell lines, enabling the authors to investigate SIVA’s role in plumbagin’s antitumor effects.
Snippet: the SIVA gene was used to overexpress SIVA in LM3 and HepG2 according to the manufacturer's instruction (SIVA ({"type":"entrez-nucleotide","attrs":{"text":"NM_006427","term_id":" 1519245345","term_text":"NM_006427"}}NM_006427) Human Tagged ORF Clone, Origene
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products