OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TRF4 2 (PAPD5) (NM_001040284) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RC214986
PAPD5 (Myc-DDK-tagged)-Human PAP associated domain containing 5 (PAPD5), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA330299 Rabbit Polyclonal Anti-PAPD5 Antibody
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "TRF4 2 or NM_001040284"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TRF4 2
Synonyms PAPD5; TRF4-2; TUT3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC214986 representing NM_001040284
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTCCAAGACCTGAGGAGGAGAAGATGCGGATGGAGGTGGTGAACAGGATCGAGAGTGTAATTAAGG
AGCTCTGGCCCAGCGCTGACGTCCAGATATTTGGAAGTTTTAAAACTGGACTTTATTTACCTACTAGTGA
CATCGACCTAGTGGTGTTTGGGAAGTGGGAGAACCTACCCCTCTGGACTCTGGAAGAAGCTCTTCGGAAA
CACAAAGTCGCAGATGAGGATTCGGTGAAAGTTTTAGACAAAGCAACTGTACCTATTATTAAATTAACAG
ATTCTTTTACTGAAGTGAAAGTTGATATCAGCTTTAATGTACAGAATGGCGTGAGAGCAGCTGACCTCAT
CAAAGATTTTACCAAGAAATATCCTGTATTGCCATACTTGGTTTTAGTATTGAAACAATTCCTATTGCAG
AGGGACCTTAATGAAGTATTTACAGGTGGAATTGGTTCTTATAGTCTCTTTTTAATGGCAGTCAGTTTCC
TTCAGTTACATCCCAGGGAAGATGCTTGCATCCCCAATACAAACTATGGTGTTCTCTTAATAGAATTTTT
TGAATTATATGGACGACACTTCAATTATTTAAAGACTGGCATCCGGATAAAGGATGGTGGTTCATATGTG
GCCAAAGATGAAGTACAGAAAAATATGCTAGATGGCTACAGGCCATCAATGCTTTATATCGAAGATCCTT
TACAACCAGGTAACGATGTTGGAAGGAGTTCATATGGGGCCATGCAAGTGAAGCAGGCCTTTGATTATGC
CTACGTTGTTTTGAGTCATGCTGTATCACCAATAGCAAAGTACTATCCCAACAATGAAACAGAAAGCATA
CTAGGTAGAATAATTAGAGTAACAGATGAAGTTGCCACATATAGAGATTGGATATCAAAGCAGTGGGGCT
TGAAGAATAGACCTGAGCCTTCATGCAATGGAAATGGTGTTACCTTGATAGTAGATACTCAGCAGTTAGA
TAAATGTAATAATAATCTATCTGAAGAAAATGAAGCCCTTGGAAAATGTAGAAGTAAAACCTCGGAATCT
CTTAGTAAACACTCTTCAAACTCTTCATCAGGTCCAGTGTCGTCCTCTTCTGCCACACAGTCCAGCTCTA
GTGATGTAGATTCCGATGCAACACCATGCAAAACCCCGAAACAGCTGCTTTGCCGTCCGTCCACTGGGAA
CCGAGTAGGGTCGCAAGATGTATCCTTGGAGTCCTCTCAGGCAGTTGGGAAAATGCAAAGCACCCAAACC
ACTAACACATCCAACAGCACCAACAAATCTCAGCATGGATCAGCAAGGCTCTTTCGTTCTTCCAGCAAAG
GCTTCCAAGGTACAACTCAAACAAGCCATGGTTCCTTGATGACAAACAAACAACATCAAGGCAAATCCAA
TAATCAGTATTACCATGGCAAAAAGAGGAAACACAAGAGGGACGCGCCCCTCTCAGACCTCTGTAGA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC214986 representing NM_001040284
Red=Cloning site Green=Tags(s)

MSPRPEEEKMRMEVVNRIESVIKELWPSADVQIFGSFKTGLYLPTSDIDLVVFGKWENLPLWTLEEALRK
HKVADEDSVKVLDKATVPIIKLTDSFTEVKVDISFNVQNGVRAADLIKDFTKKYPVLPYLVLVLKQFLLQ
RDLNEVFTGGIGSYSLFLMAVSFLQLHPREDACIPNTNYGVLLIEFFELYGRHFNYLKTGIRIKDGGSYV
AKDEVQKNMLDGYRPSMLYIEDPLQPGNDVGRSSYGAMQVKQAFDYAYVVLSHAVSPIAKYYPNNETESI
LGRIIRVTDEVATYRDWISKQWGLKNRPEPSCNGNGVTLIVDTQQLDKCNNNLSEENEALGKCRSKTSES
LSKHSSNSSSGPVSSSSATQSSSSDVDSDATPCKTPKQLLCRPSTGNRVGSQDVSLESSQAVGKMQSTQT
TNTSNSTNKSQHGSARLFRSSSKGFQGTTQTSHGSLMTNKQHQGKSNNQYYHGKKRKHKRDAPLSDLCR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001040284
ORF Size 1467 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001040284.1, NP_001035374.1
RefSeq Size 7589 bp
RefSeq ORF 2097 bp
Locus ID 64282
UniProt ID Q8NDF8
Cytogenetics 16q12.1
MW 54.6 kDa
Summary Terminal nucleotidyltransferase that catalyzes preferentially the transfert of ATP and GTP on RNA 3' poly(A) tail creating a heterogeneous 3' poly(A) tail leading to mRNAs stabilization by protecting mRNAs from active deadenylation (PubMed:21788334, PubMed:30026317). Also functions as a catalytic subunit of a TRAMP-like complex which has a poly(A) RNA polymerase activity and is involved in a post-transcriptional quality control mechanism. Polyadenylation with short oligo(A) tails is required for the degradative activity of the exosome on several of its nuclear RNA substrates. Doesn't need a cofactor for polyadenylation activity (in vitro) (PubMed:21788334, PubMed:21855801). Required for cytoplasmic polyadenylation of mRNAs involved in carbohydrate metabolism, including the glucose transporter SLC2A1/GLUT1 (PubMed:28383716). Plays a role in replication-dependent histone mRNA degradation, probably through terminal uridylation of mature histone mRNAs. May play a role in sister chromatid cohesion (PubMed:18172165). Mediates 3' adenylation of the microRNA MIR21 followed by its 3'-to-5' trimming by the exoribonuclease PARN leading to degradation (PubMed:25049417). Mediates 3' adenylation of H/ACA box snoRNAs (small nucleolar RNAs) followed by its 3'-to-5' trimming by the exoribonuclease PARN which enhances snoRNA stability and maturation (PubMed:22442037).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001040284" in other vectors (7)
SKU Description Size Price
RC214986L1 Lenti ORF clone of Human PAP associated domain containing 5 (PAPD5), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC214986L2 Lenti ORF clone of Human PAP associated domain containing 5 (PAPD5), transcript variant 1, mGFP tagged 10 ug
$757.00
RC214986L3 Lenti ORF clone of Human PAP associated domain containing 5 (PAPD5), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC214986L4 Lenti ORF clone of Human PAP associated domain containing 5 (PAPD5), transcript variant 1, mGFP tagged 10 ug
$757.00
RG214986 PAPD5 (tGFP-tagged) - Human PAP associated domain containing 5 (PAPD5), transcript variant 1 10 ug
$657.00
SC310984 PAPD5 (untagged)-Human PAP associated domain containing 5 (PAPD5), transcript variant 1 10 ug
$457.00
SC327977 PAPD5 (untagged)-Human PAP associated domain containing 5 (PAPD5) transcript variant 1 10 ug
$704.00

Plasmid Map for RC214986

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC214986
Circular map for RC214986

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products