OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TFEC (NM_001018058) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC214384
TFEC (Myc-DDK-tagged)-Human transcription factor EC (TFEC), transcript variant 2
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA811469 TFEC mouse monoclonal antibody,clone OTI1B4 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "TFEC or NM_001018058"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TFEC
Synonyms bHLHe34; hTFEC-L; TCFEC; TFE-C; TFEC-L; TFECL
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC214384 representing NM_001018058
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCCTTGATCATCAGATCATCAATCCAACTCTTAAATGGTCACAACCTGCAGTGCCAAGTGGTGGGC
CTCTTGTGCAGCATGCACACACAACTCTGGACAGTGATGCTGGCCTCACAGAAAACCCACTCACCAAGTT
ACTAGCTATTGGGAAAGAAGATGACAATGCACAATGGCATTTATCTGGAAGTATTTTGGATGTGTATAGC
GGTGAACAAGGAATTTCACCAATTAACATGGGGCTTACAAGTGCTTCTTGTCCAAGTAGTCTACCAATGA
AAAGAGAAATTACAGAAACTGACACTAGAGCTTTAGCAAAAGAGAGACAAAAAAAGGACAACCACAACCT
CATTGAAAGAAGAAGAAGGTATAATATTAATTACCGAATCAAGGAGCTTGGCACTCTTATTCCAAAGTCT
AATGATCCTGATATGCGCTGGAACAAAGGAACCATTCTAAAAGCATCAGTGGAGTACATCAAGTGGCTAC
AAAAAGAACAACAGAGAGCCCGAGAATTGGAACACAGACAGAAGAAATTAGAGCAGGCTAACAGGCGACT
TCTACTTCGGATTCAGGAACTAGAAATTCAGGCTCGTACTCATGGTCTGCCAACCCTGGCTTCACTTGGC
ACGGTTGATTTAGGTGCTCATGTCACCAAACAGCAGAGCCATCCTGAGCAGAATTCAGTAGACTATTGCC
AACAACTGACTGTGTCTCAGGGGCCAAGCCCTGAGCTCTGTGATCAAGCTATAGCCTTTTCTGATCCTTT
GTCATACTTCACAGATTTATCATTTAGTGCTGCATTGAAAGAGGAACAAAGATTGGATGGCATGCTATTG
GATGACACAATCTCTCCATTTGGAACAGATCCTCTGCTATCTGCCACTTCCCCTGCAGTTTCCAAAGAAA
GCAGTAGGAGAAGTAGCTTTAGCTCAGATGATGGTGATGAATTA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC214384 representing NM_001018058
Red=Cloning site Green=Tags(s)

MTLDHQIINPTLKWSQPAVPSGGPLVQHAHTTLDSDAGLTENPLTKLLAIGKEDDNAQWHLSGSILDVYS
GEQGISPINMGLTSASCPSSLPMKREITETDTRALAKERQKKDNHNLIERRRRYNINYRIKELGTLIPKS
NDPDMRWNKGTILKASVEYIKWLQKEQQRARELEHRQKKLEQANRRLLLRIQELEIQARTHGLPTLASLG
TVDLGAHVTKQQSHPEQNSVDYCQQLTVSQGPSPELCDQAIAFSDPLSYFTDLSFSAALKEEQRLDGMLL
DDTISPFGTDPLLSATSPAVSKESSRRSSFSSDDGDEL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001018058
ORF Size 954 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001018058.3
RefSeq Size 6544 bp
RefSeq ORF 957 bp
Locus ID 22797
UniProt ID O14948
Cytogenetics 7q31.2
Protein Families Druggable Genome, Transcription Factors
MW 35.4 kDa
Summary This gene encodes a member of the micropthalmia (MiT) family of basic helix-loop-helix leucine zipper transcription factors. MiT transcription factors regulate the expression of target genes by binding to E-box recognition sequences as homo- or heterodimers, and play roles in multiple cellular processes including survival, growth and differentiation. The encoded protein is a transcriptional activator of the nonmuscle myosin II heavy chain-A gene, and may also co-regulate target genes in osteoclasts as a heterodimer with micropthalmia-associated transcription factor. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. provided by RefSeq, Sep 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001018058" in other vectors (6)
SKU Description Size Price
RC214384L1 Lenti ORF clone of Human transcription factor EC (TFEC), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC214384L2 Lenti ORF clone of Human transcription factor EC (TFEC), transcript variant 2, mGFP tagged 10 ug
$600.00
RC214384L3 Lenti ORF clone of Human transcription factor EC (TFEC), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC214384L4 Lenti ORF clone of Human transcription factor EC (TFEC), transcript variant 2, mGFP tagged 10 ug
$600.00
RG214384 TFEC (tGFP-tagged) - Human transcription factor EC (TFEC), transcript variant 2 10 ug
$489.00 $500.00
SC302148 TFEC (untagged)-Human transcription factor EC (TFEC), transcript variant 2 10 ug
$300.00

Plasmid Map for RC214384

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC214384
Circular map for RC214384

file-alt Citations

MiT/TFE transcription factors are activated during mitophagy downstream of Parkin and Atg5
Nezich, Wang, Fogel et al
J. Cell Biol. (2015) 210 (3), 435-50 DOI: 10.1083/jcb.201501002
Cited by 318
AI Summary: OriGene contributed to this study by providing the pCMV6-Entry-TFEC-Myc-DDK plasmid, which was used to investigate the role of TFEC in mitophagy and MiT/TFE transcription factor activation.
Snippet: Tokyo, Japan;Hara et al., 2008), and the pMXs-IP-EGFP-mAtg5-K130R mutant was generated by site-directed mutagenesis;plasmid 19302, pRK5-HA-GST-RagB54L, plasmid 19303, pRK5-HA-GST-RagB99L, plasmid 19308, pRK5-HA-GST-RagD77L, and plasmid 19309, pRK5-HA-GST-RagD121L, all contain a CMV promoter within the pRK5-HA backbone vector and were gifts from D. Sabatini (Whitehead Institute for Biomedical Research, Massachusetts Institute of Technology, and Broad Institute, Cambridge, MA;Sancak et al., 2008). The pCMV6-Entry-TFEC-Myc-DDK construct was obtained from OriGene
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products