OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CHRM2 (NM_000739) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC212791
CHRM2 (Myc-DDK-tagged)-Human cholinergic receptor, muscarinic 2 (CHRM2), transcript variant 4
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA313310 Rabbit polyclonal anti-CHRM2 antibody
100 ul
$380.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "CHRM2 or NM_000739"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CHRM2
Synonyms HM2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC212791 representing NM_000739
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATAACTCAACAAACTCCTCTAACAATAGCCTGGCTCTTACAAGTCCTTATAAGACATTTGAAGTGG
TGTTTATTGTCCTGGTGGCTGGATCCCTCAGTTTGGTGACCATTATCGGGAACATCCTAGTCATGGTTTC
CATTAAAGTCAACCGCCACCTCCAGACCGTCAACAATTACTTTTTATTCAGCTTGGCCTGTGCTGACCTT
ATCATAGGTGTTTTCTCCATGAACTTGTACACCCTCTACACTGTGATTGGTTACTGGCCTTTGGGACCTG
TGGTGTGTGACCTTTGGCTAGCCCTGGACTATGTGGTCAGCAATGCCTCAGTTATGAATCTGCTCATCAT
CAGCTTTGACAGGTACTTCTGTGTCACAAAACCTCTGACCTACCCAGTCAAGCGGACCACAAAAATGGCA
GGTATGATGATTGCAGCTGCCTGGGTCCTCTCTTTCATCCTCTGGGCTCCAGCCATTCTCTTCTGGCAGT
TCATTGTAGGGGTGAGAACTGTGGAGGATGGGGAGTGCTACATTCAGTTTTTTTCCAATGCTGCTGTCAC
CTTTGGTACGGCTATTGCAGCCTTCTATTTGCCAGTGATCATCATGACTGTGCTATATTGGCACATATCC
CGAGCCAGCAAGAGCAGGATAAAGAAGGACAAGAAGGAGCCTGTTGCCAACCAAGACCCCGTTTCTCCAA
GTCTGGTACAAGGAAGGATAGTGAAGCCAAACAATAACAACATGCCCAGCAGTGACGATGGCCTGGAGCA
CAACAAAATCCAGAATGGCAAAGCCCCCAGGGATCCTGTGACTGAAAACTGTGTTCAGGGAGAGGAGAAG
GAGAGCTCCAATGACTCCACCTCAGTCAGTGCTGTTGCCTCTAATATGAGAGATGATGAAATAACCCAGG
ATGAAAACACAGTTTCCACTTCCCTGGGCCATTCCAAAGATGAGAACTCTAAGCAAACATGCATCAGAAT
TGGCACCAAGACCCCAAAAAGTGACTCATGTACCCCAACTAATACCACCGTGGAGGTAGTGGGGTCTTCA
GGTCAGAATGGAGATGAAAAGCAGAATATTGTAGCCCGCAAGATTGTGAAGATGACTAAGCAGCCTGCAA
AAAAGAAGCCTCCTCCTTCCCGGGAAAAGAAAGTCACCAGGACAATCTTGGCTATTCTGTTGGCTTTCAT
CATCACTTGGGCCCCATACAATGTCATGGTGCTCATTAACACCTTTTGTGCACCTTGCATCCCCAACACT
GTGTGGACAATTGGTTACTGGCTTTGTTACATCAACAGCACTATCAACCCTGCCTGCTATGCACTTTGCA
ATGCCACCTTCAAGAAGACCTTTAAACACCTTCTCATGTGTCATTATAAGAACATAGGCGCTACAAGG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC212791 representing NM_000739
Red=Cloning site Green=Tags(s)

MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNYFLFSLACADL
IIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTYPVKRTTKMA
GMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQFFSNAAVTFGTAIAAFYLPVIIMTVLYWHIS
RASKSRIKKDKKEPVANQDPVSPSLVQGRIVKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEK
ESSNDSTSVSAVASNMRDDEITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSS
GQNGDEKQNIVARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_000739
ORF Size 1398 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000739.3
RefSeq Size 2530 bp
RefSeq ORF 1401 bp
Locus ID 1129
UniProt ID P08172, A4D1Q0, Q6SL56, Q86SJ1
Cytogenetics 7q33
Protein Families Druggable Genome, GPCR, Transmembrane
Protein Pathways Calcium signaling pathway, Neuroactive ligand-receptor interaction, Regulation of actin cytoskeleton
MW 51.5 kDa
Summary The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine to these receptors and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The muscarinic cholinergic receptor 2 is involved in mediation of bradycardia and a decrease in cardiac contractility. Multiple alternatively spliced transcript variants have been described for this gene. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_000739" in other vectors (6)
SKU Description Size Price
RC212791L1 Lenti ORF clone of Human cholinergic receptor, muscarinic 2 (CHRM2), transcript variant 4, Myc-DDK-tagged 10 ug
$757.00
RC212791L2 Lenti ORF clone of Human cholinergic receptor, muscarinic 2 (CHRM2), transcript variant 4, mGFP tagged 10 ug
$757.00
RC212791L3 Lenti ORF clone of Human cholinergic receptor, muscarinic 2 (CHRM2), transcript variant 4, Myc-DDK-tagged 10 ug
$757.00
RC212791L4 Lenti ORF clone of Human cholinergic receptor, muscarinic 2 (CHRM2), transcript variant 4, mGFP tagged 10 ug
$757.00
RG212791 CHRM2 (tGFP-tagged) - Human cholinergic receptor, muscarinic 2 (CHRM2), transcript variant 4 10 ug
$489.00 $657.00
SC110855 CHRM2 (untagged)-Human cholinergic receptor, muscarinic 2 (CHRM2), transcript variant 4 10 ug
$457.00

Plasmid Map for RC212791

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC212791
Circular map for RC212791

file-alt Citations

Autoantibodies Blocking M3 Muscarinic Receptors Cause Postganglionic Cholinergic Dysautonomia
Palma, Gupta, Sierra et al
Ann. Neurol. (2020)
Cited by 13
AI Summary: OriGene’s myc-tagged human muscarinic M1, M2, M3, M4, and M5 receptor expression constructs were used to transfect CHO cells, enabling the detection and analysis of patient autoantibodies against specific muscarinic receptor subtypes in this study.
Snippet: Chinese hamster ovary (CHO) cells were grown and transfected to express the human muscarinic M1, M2, M3, M4 or M5 receptors as a tagged protein with the N-terminal myc-tag (Origene, Rockville, MD, USA). Membranes were prepared
Comparison and evaluation of antimuscarinic and anti-inflammatory effects of five Bulbus fritillariae species based on UPLC-Q/TOF integrated dual-luciferase reporter assay, PCA and ANN analysis
Zhou, Ma, Ding et al
J. Chromatogr. B Analyt. Technol. Biomed. Life Sci. (2016) 1041-1042, 60-69 DOI: 10.1016/j.jchromb.2016.12.012
AI Summary: OriGene products, specifically the CHRM1 (Cat. No. RC212436) and CHRM3 (Cat. No. RC212791) gene constructs, were used to establish stable cell lines for dual-luciferase reporter assays to evaluate the antimuscarinic and anti-inflammatory effects of Bulbus fritillariae species in this study.
Snippet: No. RC212436) and M 3 R gene (Cat. No. RC212791) were purchased from OriGene, USA. The cells were cultured in the aforementioned medium with 100 μg/mL neomycin added to stabilize the cell lines. 2.4. Bioactivity assays with a dual-luciferase reporter assay ... Cite SaveSaving
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products