OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NPHS2 (NM_014625) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC212676
NPHS2 (Myc-DDK-tagged)-Human nephrosis 2, idiopathic, steroid-resistant (podocin) (NPHS2)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
  $686.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA371448 NPHS2 rabbit polyclonal antibody
100 ul
$310.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "NPHS2 or NM_014625"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NPHS2
Synonyms PDCN; SRN1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC212676 representing NM_014625
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGAGGAGGGCGCGGAGCTCCTCCAGGGAGTCCCGCGGGCGAGGCGGCAGGACTCCGCACAAGGAGA
ACAAGAGGGCAAAGGCCGAGAGGAGCGGCGGGGGCCGCGGGCGCCAGGAGGCTGGGCCCGAGCCGTCGGG
CTCCGGACGGGCGGGGACCCCGGGGGAGCCCCGAGCGCCCGCCGCCACGGTGGTGGACGTGGATGAGGTC
CGAGGCTCCGGCGAGGAGGGCACCGAGGTGGTGGCGCTGTTGGAGAGCGAGCGGCCCGAGGAAGGTACCA
AATCCTCTGGCTTAGGGGCCTGTGAGTGGCTTCTTGTCCTCATTTCCCTGCTCTTCATCATCATGACCTT
CCCTTTTTCCATCTGGTTCTGCGTAAAGGTTGTACAAGAGTATGAAAGAGTAATTATATTCCGACTGGGA
CATCTGCTTCCTGGAAGAGCCAAAGGCCCTGGTCTTTTCTTTTTTTTGCCCTGCCTGGATACCTACCACA
AGGTTGACCTTCGTCTCCAAACTCTGGAGATACCTTTTCATGAGATCGTGACCAAAGACATGTTTATAAT
GGAGATAGATGCCATTTGCTACTACCGAATGGAAAATGCCTCTCTTCTCCTAAGCAGTCTTGCTCATGTA
TCTAAAGCTGTGCAATTCCTTGTGCAAACCACTATGAAGCGTCTCCTAGCACATCGATCCCTCACTGAAA
TTCTTCTAGAGAGGAAGAGCATCGCCCAAGATGCAAAGGTTGCCTTGGATTCAGTGACCTGTATTTGGGG
AATCAAAGTGGAGAGAATAGAAATTAAAGATGTGAGGTTGCCAGCTGGGCTTCAGCACTCACTGGCTGTG
GAGGCTGAAGCGCAAAGACAAGCCAAAGTGCGGATGATTGCTGCAGAAGCGGAAAAGGCTGCTTCTGAGT
CCCTGAGGATGGCAGCTGAGATTCTGTCAGGCACCCCTGCTGCCGTTCAGCTTCGATACCTCCACACCCT
TCAGTCTCTGTCCACAGAGAAGCCTTCCACTGTGGTTTTACCTTTGCCATTTGACCTGCTGAATTGCCTG
TCTTCTCCCAGCAACAGAACTCAGGGAAGCCTCCCCTTCCCAAGTCCTTCCAAACCTGTTGAGCCACTAA
ATCCTAAAAAGAAAGACTCTCCCATGTTA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC212676 representing NM_014625
Red=Cloning site Green=Tags(s)

MERRARSSSRESRGRGGRTPHKENKRAKAERSGGGRGRQEAGPEPSGSGRAGTPGEPRAPAATVVDVDEV
RGSGEEGTEVVALLESERPEEGTKSSGLGACEWLLVLISLLFIIMTFPFSIWFCVKVVQEYERVIIFRLG
HLLPGRAKGPGLFFFLPCLDTYHKVDLRLQTLEIPFHEIVTKDMFIMEIDAICYYRMENASLLLSSLAHV
SKAVQFLVQTTMKRLLAHRSLTEILLERKSIAQDAKVALDSVTCIWGIKVERIEIKDVRLPAGLQHSLAV
EAEAQRQAKVRMIAAEAEKAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPSTVVLPLPFDLLNCL
SSPSNRTQGSLPFPSPSKPVEPLNPKKKDSPML

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene |
ACCN NM_014625
ORF Size 1149 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014625.4
RefSeq Size 1853 bp
RefSeq ORF 1152 bp
Locus ID 7827
UniProt ID Q9NP85
Cytogenetics 1q25.2
Protein Families Transmembrane
MW 42 kDa
Summary This gene encodes a protein that plays a role in the regulation of glomerular permeability. Mutations in this gene cause steroid-resistant nephrotic syndrome. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jul 2014
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_014625" in other vectors (6)
SKU Description Size Price
RC212676L1 Lenti ORF clone of Human nephrosis 2, idiopathic, steroid-resistant (podocin) (NPHS2), Myc-DDK-tagged 10 ug
$986.00
RC212676L2 Lenti ORF clone of Human nephrosis 2, idiopathic, steroid-resistant (podocin) (NPHS2), mGFP tagged 10 ug
$986.00
RC212676L3 Lenti ORF clone of Human nephrosis 2, idiopathic, steroid-resistant (podocin) (NPHS2), Myc-DDK-tagged 10 ug
$986.00
RC212676L4 Lenti ORF clone of Human nephrosis 2, idiopathic, steroid-resistant (podocin) (NPHS2), mGFP tagged 10 ug
$986.00
RG212676 NPHS2 (tGFP-tagged) - Human nephrosis 2, idiopathic, steroid-resistant (podocin) (NPHS2) 10 ug
$886.00
SC304144 NPHS2 (untagged)-Human nephrosis 2, idiopathic, steroid-resistant (podocin) (NPHS2) 10 ug
$686.00

file-alt Citations

Co-Inheritance of Functional Podocin Variants with Heterozygous Collagen IV Mutations Predisposes to Renal Failure
Stefanou, Pieri, Savva et al
Nephron (2015) 130 (3), 200-212 DOI: 10.1159/000432406
Cited by 26
AI Summary: OriGene contributed to this study by providing the pCMV6-entry-Myc/DDK vector containing full-length human podocin (NPHS2) cDNA, which was used for functional cell culture experiments investigating the effects of podocin variants.
Snippet: Plasmid Vectors. A pCMV6-entry-Myc/DDK vector containing the full-length human podocin (NPHS2) cDNA was purchased from Origene (Maryland, USA). Additionally, cDNA of NPHS2-wt was subloned from pCMV6-NPHS2-wt-Myc/DDK to pCMV6-AC-HA vector. ... Cited by 1 Cite SaveSaving
Inducible Expression of Claudin-1 in Glomerular Podocytes Generates Aberrant Tight Junctions and Proteinuria through Slit Diaphragm Destabilization
Gong, Sunq, Roth et al
J. Am. Soc. Nephrol. (2017) 28 (1), 106-117 DOI: 10.1681/ASN.2015121324
AI Summary: OriGene products contributed to this study by providing specific genes used for experimental analyses, as stated in the methods section ("genes were purchased from OriGene Technologies"), which facilitated the investigation of claudin-1's role in podocyte function and disease.
Snippet: ...Concise Methods Reagents, Antibodies, and Cell Lines The primers, chemicals, and antibodies used in this study are...genes were purchased from Origene Technologies (Rockville...IgG (as negative CON) antibodies. Antibody-bound material...
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products