OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CRISP1 (NM_001131) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC212061
CRISP1 (Myc-DDK-tagged)-Human cysteine-rich secretory protein 1 (CRISP1), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA372373 CRISP1 rabbit polyclonal antibody
100 ul
$310.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "CRISP1 or NM_001131"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CRISP1
Synonyms AEGL1; ARP; CRISP-1; HEL-S-57; HSCRISP1D; HSCRISP1G; HUMARP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC212061 representing NM_001131
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAATTAAACACCTCTTGTTTTTGGTTGCTGCTGCTTGCTTACTGCCTATGTTGTCCATGAAAAAGA
AATCAGCTAGAGACCAATTTAATAAGCTCGTCACCGACTTGCCAAATGTACAAGAAGAGATCGTTAATAT
ACACAACGCCCTCAGGAGAAGAGTAGTTCCACCAGCCAGCAACATGCTGAAGATGAGTTGGAGTGAAGAG
GCTGCACAAAATGCCAGAATTTTTTCAAAGTATTGTGATATGACAGAGAGCAACCCCCTTGAGAGGAGAC
TTCCAAATACCTTTTGTGGAGAAAATATGCATATGACATCTTATCCTGTATCATGGTCAAGTGTAATTGG
AGTCTGGTACAGTGAGTCTACAAGTTTCAAACATGGAGAATGGACAACAACGGATGATGACATAACTACT
GACCACTACACTCAGATTGTTTGGGCCACATCTTACCTGATTGGCTGTGCCATTGCATCTTGCCGCCAAC
AAGGATCACCTCGATATCTCTACGTTTGTCACTATTGTCATGAGGGAAATGATCCTGAAACAAAGAATGA
ACCTTATAAGACAGGCGTCCCATGTGAAGCCTGCCCAAGTAACTGTGAAGACAAACTTTGCACTAACCCC
TGCATCTACTATGATGAATACTTCGACTGTGACATACAAGTCCATTATCTGGGATGCAACCACTCAACAA
CTATCCTATTCTGTAAAGCCACTTGTCTGTGTGACACTGAGATAAAA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC212061 representing NM_001131
Red=Cloning site Green=Tags(s)

MEIKHLLFLVAAACLLPMLSMKKKSARDQFNKLVTDLPNVQEEIVNIHNALRRRVVPPASNMLKMSWSEE
AAQNARIFSKYCDMTESNPLERRLPNTFCGENMHMTSYPVSWSSVIGVWYSESTSFKHGEWTTTDDDITT
DHYTQIVWATSYLIGCAIASCRQQGSPRYLYVCHYCHEGNDPETKNEPYKTGVPCEACPSNCEDKLCTNP
CIYYDEYFDCDIQVHYLGCNHSTTILFCKATCLCDTEIK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001131
ORF Size 747 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001131.3
RefSeq Size 1892 bp
RefSeq ORF 750 bp
Locus ID 167
UniProt ID P54107, A0A0K0K1I1
Cytogenetics 6p12.3
MW 28.48 kDa
Summary Fertilization consists of a sequence of specific cell-cell interactions culminating in the fusion of the sperm and egg plasma membranes. Recognition, binding, and fusion occur through the interaction of complementary molecules that are localized to specific domains of the sperm and egg plasma membranes. In the sperm, the postacrosomal region or equatorial segment is involved in sperm-egg plasma membrane fusion. The protein encoded by this gene is a member of the cysteine-rich secretory protein (CRISP) family. It is expressed in the epididymis, is secreted into the epididymal lumen, and binds to the postacrosomal region of the sperm head, where it plays a role in sperm-egg fusion. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Mar 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001131" in other vectors (6)
SKU Description Size Price
RC212061L1 Lenti ORF clone of Human cysteine-rich secretory protein 1 (CRISP1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC212061L2 Lenti ORF clone of Human cysteine-rich secretory protein 1 (CRISP1), transcript variant 1, mGFP tagged 10 ug
$600.00
RC212061L3 Lenti ORF clone of Human cysteine-rich secretory protein 1 (CRISP1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC212061L4 Lenti ORF clone of Human cysteine-rich secretory protein 1 (CRISP1), transcript variant 1, mGFP tagged 10 ug
$600.00
RG212061 CRISP1 (tGFP-tagged) - Human cysteine-rich secretory protein 1 (CRISP1), transcript variant 1 10 ug
$500.00
SC302975 CRISP1 (untagged)-Human cysteine-rich secretory protein 1 (CRISP1), transcript variant 1 10 ug
$300.00

Plasmid Map for RC212061

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC212061
Circular map for RC212061

file-alt Citations

The less conserved metal-binding site in human CRISP1 remains sensitive to zinc ions to permit protein oligomerization
Sheng, Gadella, Olrichs et al
Sci Rep (2021) 11 (1), 5498 DOI: 10.1038/s41598-021-84926-y
Cited by 8
AI Summary: OriGene contributed to this study by providing the human CRISP1 cDNA (NM_001131), which was used as a template for generating recombinant proteins to investigate zinc-induced oligomerization.
Snippet: Aldrich (St. Louis, MO, USA), and bis(sulfosuccinimidyl)suberate (BS3) was from Pierce Biotechnology (Rockford, IL, USA). Plasmid construction The cDNA of human CRISP1 (NM_001131) was obtained from OriGene (Rockville, MD, USA). cDNA of human CRISP1 was used as a template in a PCR reaction. 5′-cggaattcaaaaagaaatcagctagagacc-3′ was used as the forward primer, and 5′-gcaagctttcattttatctcagtgt
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products