OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GATA3 (NM_001002295) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC211904
GATA3 (Myc-DDK-tagged)-Human GATA binding protein 3 (GATA3), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA809095 GATA3 mouse monoclonal antibody, clone OTI8H4 (formerly 8H4) 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "GATA3 or NM_001002295"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GATA3
Synonyms HDR; HDRS
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC211904 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGTGACGGCGGACCAGCCGCGCTGGGTGAGCCACCACCACCCCGCCGTGCTCAACGGGCAGCACC
CGGACACGCACCACCCGGGCCTCAGCCACTCCTACATGGACGCGGCGCAGTACCCGCTGCCGGAGGAGGT
GGATGTGCTTTTTAACATCGACGGTCAAGGCAACCACGTCCCGCCCTACTACGGAAACTCGGTCAGGGCC
ACGGTGCAGAGGTACCCTCCGACCCACCACGGGAGCCAGGTGTGCCGCCCGCCTCTGCTTCATGGATCCC
TACCCTGGCTGGACGGCGGCAAAGCCCTGGGCAGCCACCACACCGCCTCCCCCTGGAATCTCAGCCCCTT
CTCCAAGACGTCCATCCACCACGGCTCCCCGGGGCCCCTCTCCGTCTACCCCCCGGCCTCGTCCTCCTCC
TTGTCGGGGGGCCACGCCAGCCCGCACCTCTTCACCTTCCCGCCCACCCCGCCGAAGGACGTCTCCCCGG
ACCCATCGCTGTCCACCCCAGGCTCGGCCGGCTCGGCCCGGCAGGACGAGAAAGAGTGCCTCAAGTACCA
GGTGCCCCTGCCCGACAGCATGAAGCTGGAGTCGTCCCACTCCCGTGGCAGCATGACCGCCCTGGGTGGA
GCCTCCTCGTCGACCCACCACCCCATCACCACCTACCCGCCCTACGTGCCCGAGTACAGCTCCGGACTCT
TCCCCCCCAGCAGCCTGCTGGGCGGCTCCCCCACCGGCTTCGGATGCAAGTCCAGGCCCAAGGCCCGGTC
CAGCACAGAAGGCAGGGAGTGTGTGAACTGTGGGGCAACCTCGACCCCACTGTGGCGGCGAGATGGCACG
GGACACTACCTGTGCAACGCCTGCGGGCTCTATCACAAAATGAACGGACAGAACCGGCCCCTCATTAAGC
CCAAGCGAAGGCTGTCTGCAGCCAGGAGAGCAGGGACGTCCTGTGCGAACTGTCAGACCACCACAACCAC
ACTCTGGAGGAGGAATGCCAATGGGGACCCTGTCTGCAATGCCTGTGGGCTCTACTACAAGCTTCACAAT
ATTAACAGACCCCTGACTATGAAGAAGGAAGGCATCCAGACCAGAAACCGAAAAATGTCTAGCAAATCCA
AAAAGTGCAAAAAAGTGCATGACTCACTGGAGGACTTCCCCAAGAACAGCTCGTTTAACCCGGCCGCCCT
CTCCAGACACATGTCCTCCCTGAGCCACATCTCGCCCTTCAGCCACTCCAGCCACATGCTGACCACGCCC
ACGCCGATGCACCCGCCATCCAGCCTGTCCTTTGGACCACACCACCCCTCCAGCATGGTCACCGCCATGG
GT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC211904 protein sequence
Red=Cloning site Green=Tags(s)

MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHVPPYYGNSVRA
TVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSS
LSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVPLPDSMKLESSHSRGSMTALGG
ASSSTHHPITTYPPYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTEGRECVNCGATSTPLWRRDGT
GHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHN
INRPLTMKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTP
TPMHPPSSLSFGPHHPSSMVTAMG

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001002295
ORF Size 1332 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001002295.2
RefSeq Size 3070 bp
RefSeq ORF 1335 bp
Locus ID 2625
UniProt ID P23771
Cytogenetics 10p14
Protein Families Adult stem cells, ES Cell Differentiation/IPS, Stem cell relevant signaling - JAK/STAT signaling pathway, Transcription Factors
MW 48 kDa
Summary This gene encodes a protein which belongs to the GATA family of transcription factors. The protein contains two GATA-type zinc fingers and is an important regulator of T-cell development and plays an important role in endothelial cell biology. Defects in this gene are the cause of hypoparathyroidism with sensorineural deafness and renal dysplasia. provided by RefSeq, Nov 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001002295" in other vectors (6)
SKU Description Size Price
RC211904L1 Lenti ORF clone of Human GATA binding protein 3 (GATA3), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC211904L2 Lenti ORF clone of Human GATA binding protein 3 (GATA3), transcript variant 1, mGFP tagged 10 ug
$757.00
RC211904L3 Lenti ORF clone of Human GATA binding protein 3 (GATA3), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC211904L4 Lenti ORF clone of Human GATA binding protein 3 (GATA3), transcript variant 1, mGFP tagged 10 ug
$757.00
RG211904 GATA3 (tGFP-tagged) - Human GATA binding protein 3 (GATA3), transcript variant 1 10 ug
$489.00 $657.00
SC300437 GATA3 (untagged)-Human GATA binding protein 3 (GATA3), transcript variant 1 10 ug
$457.00

Plasmid Map for RC211904

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC211904
Circular map for RC211904

file-alt Citations

NKL homeobox gene MSX1 acts like a tumor suppressor in NK-cell leukemia
Nagel, Pommerenke, Meyer et al
Oncotarget (2017) 8 (40), 66815-66832 DOI: 10.18632/oncotarget.18609
Snippet: Expression constructs for GATA3, HHEX, IRF4, MSX1, PCGF5 and PRDM1 were cloned in vector pCMV6 and obtained from Origene (Wiesbaden, Germany)
FigureFigureFigure
FOXA1, GATA3 and PPARɣ Cooperate to Drive Luminal Subtype in Bladder Cancer: A Molecular Analysis of Established Human Cell Lines
Warrick, Walter, Yamashita et al
Sci Rep (2016) 6, 38531 DOI: 10.1038/srep38531
AI Summary: OriGene products pCMV6-Entry (empty vector), pCMV6-FOXA1 (RC206045), and pCMV6-GATA3 (RC211904) were used to transfect bladder cancer cell lines, enabling the study of how FOXA1 and GATA3 overexpression contributes to luminal subtype differentiation.
Snippet: The following day, attached cells were transfected with the following plasmid constructs: pCMV6-Entry (CMV empty vector;Origene, Rockville MD), pCMV6-FOXA1 (Origene;RC206045), pCMV6-GATA3 (Origene;RC211904), or a combination of pCMV6-FOXA1 and pCMV6-GATA3 using Lipofectamine 3000 (Life Technologies, Carlsbad CA),
FigureFigureFigure
Transcription Factors with Conserved Binding Sites Near ATOH1 on the POU4F3 Gene Enhance the Induction of Cochlear Hair Cells
Ikeda, Pak, Chavez et al
Mol. Neurobiol. (2014)
Cited by 46
AI Summary: OriGene contributed to this study by providing all the plasmids used for transfection, including those encoding the transcription factors tested for their effects on cochlear hair cell induction.
Snippet: 2). All plasmids were purchased from OriGene (Rockville, MD, USA). Five days after transfection, GFP fluorescence was evaluated, and immunolabelling was carried out to detect myosin 7A+, which in the inner ear is a specific marker for the HC phenotype [18]. ... Cite SaveSaving
Repressed BMP-signalling reactivates NKL homeobox gene MSX1 in a T-ALL subset
Nagel, Ehrentraut, Meyer et al
Leuk. Lymphoma (2014)
Cited by 31
AI Summary: OriGene products contributed expression constructs encoding FOXC1, GATA3, PITX1, and TAL1, which were used in knockdown and overexpression studies to investigate their regulatory roles in MSX1 transcription in T-ALL cells.
Snippet: si)RNAs by electroporation using the EPI-2500 impulse generator (Fischer, Heidelberg, Germany) at 350 V for 10 ms, and subsequently incubated for 16 h. Expression constructs encoding FOXC1, GATA3, PITX1 and TAL1 were obtained from Origene (Wiesbaden, ... Cite SaveSaving
Showing 1-4 of 4 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products