OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RPL22L1 (NM_001099645) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC211790
RPL22L1 (Myc-DDK-tagged)-Human ribosomal protein L22-like 1 (RPL22L1)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $150.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "RPL22L1 or NM_001099645"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RPL22L1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC211790 representing NM_001099645
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCCGCAGAAAGACAGGAAGCCCAAGAGGTCAACCTGGAGGTTTAATTTGGACCTTACTCATCCAG
TAGAAGATGGAATTTTTGATTCTGGAAATTTTGAGCAATTTCTACGGGAGAAGGTTAAAGTCAATGGCAA
AACTGGAAATCTCGGGAATGTTGTTCACATTGAACGCTTCAAGAATAAAATCACAGTTGTTTCTGAGAAA
CAGTTCTCTAAAAGGTATTTGAAATACCTTACCAAGAAATACCTTAAGAAGAACAATCTTCGTGATTGGC
TTCGAGTGGTTGCATCTGACAAGGAGACCTACGAACTTCGTTACTTCCAGATTAGTCAAGATGAAGATGA
ATCAGAGTCGGAGGAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC211790 representing NM_001099645
Red=Cloning site Green=Tags(s)

MAPQKDRKPKRSTWRFNLDLTHPVEDGIFDSGNFEQFLREKVKVNGKTGNLGNVVHIERFKNKITVVSEK
QFSKRYLKYLTKKYLKKNNLRDWLRVVASDKETYELRYFQISQDEDESESED

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001099645
ORF Size 366 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001099645.2
RefSeq Size 1978 bp
RefSeq ORF 369 bp
Locus ID 200916
UniProt ID Q6P5R6
Cytogenetics 3q26.2
Protein Pathways Ribosome
MW 14.6 kDa
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001099645" in other vectors (4)
SKU Description Size Price
RC211790L3 Lenti-ORF clone of RPL22L1 (Myc-DDK-tagged)-Human ribosomal protein L22-like 1 (RPL22L1) 10 ug
$450.00
RC211790L4 Lenti-ORF clone of RPL22L1 (mGFP-tagged)-Human ribosomal protein L22-like 1 (RPL22L1) 10 ug
$450.00
RG211790 RPL22L1 (tGFP-tagged) - Human ribosomal protein L22-like 1 (RPL22L1) 10 ug
$350.00
SC316648 RPL22L1 (untagged)-Human ribosomal protein L22-like 1 (RPL22L1) 10 ug
$165.00

Plasmid Map for RC211790

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC211790
Circular map for RC211790

file-alt Citations

Ribosomal RNA transcription regulates splicing through ribosomal protein RPL22
Fan, Liu, Stachelek et al
Cell Chem Biol (2025)
Cited by 9
AI Summary: OriGene’s pCMV6-RPL22L1-myc-DDK plasmid (Cat# RC211790) was used in this study to express RPL22L1, enabling functional analyses of its role in alternative splicing and the cellular response to ribosomal RNA transcription inhibition.
Snippet: pCMV6-RPL22L1-myc-DDK Origene Cat#RC211790 pLenti-GIII-CMV-RPL22-HA Applied Biological Materials Cat#LV291610 pLenti-GIII-CMV-RPL22L1-HA App
The ribosomal protein L22 binds the MDM4 pre-mRNA and promotes exon skipping to activate p53 upon nucleolar stress
Jansen, Bohnsack, Böhlken-Fascher et al
Cell Rep (2024) 43 (8), 114610 DOI: 10.1016/j.celrep.2024.114610
Cited by 21
AI Summary: OriGene products contributed to this study by providing the pCMV6Entry empty control (Cat# PS100001), pCMV6Entry-L22 (Cat# RC208910), and pCMV6Entry-L22L1 (Cat# RC211790) plasmids, which were used to investigate the roles of L22 and L22L1 in regulating MDM4 pre-mRNA splicing and p53 activation.
Snippet: pCMV6Entry (empty control) Origene/VWR Cat# PS100001 pCMV6Entry-L22 Origene Cat# RC208910 pCMV6Entry-L22L1 Origene Cat# RC211790
Ribosomal RNA transcription governs splicing through ribosomal protein RPL22
Fan, Liu, Stachelek et al
bioRxiv (2024)
Cited by 2
Snippet: pCMV6-RPL22L1-myc-DDK vector was obtained from Origene (cat # RC211790). Human RPL22 and RPL22L1 cDNAs were amplified from pLenti-GIII-CMV-RPL22-HA and pLenti-GIII-CMV-RPL22L1-HA (Applied Biological Materials, cat # LV291610, cat # LV802168) then cloned into a PB-EF1α-MCSIRES-GFP PiggyBac expression vector (System Biosciences, cat # PB530A-2)
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products