OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LY6E (NM_002346) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RC211373
LY6E (Myc-DDK-tagged)-Human lymphocyte antigen 6 complex, locus E (LY6E), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
  $289.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA378169 LY6E Rabbit polyclonal Antibody
100 ul
$410.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "LY6E or NM_002346"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol LY6E
Synonyms RIG-E; RIGE; SCA-2; SCA2; TSA-1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC211373 representing NM_002346
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGATCTTCTTGCCAGTGCTGCTGGCTGCCCTTCTGGGTGTGGAGCGAGCCAGCTCGCTGATGTGCT
TCTCCTGCTTGAACCAGAAGAGCAATCTGTACTGCCTGAAGCCGACCATCTGCTCCGACCAGGACAACTA
CTGCGTGACTGTGTCTGCTAGTGCCGGCATTGGGAATCTCGTGACATTTGGCCACAGCCTGAGCAAGACC
TGTTCCCCGGCCTGCCCCATCCCAGAAGGCGTCAATGTTGGTGTGGCTTCCATGGGCATCAGCTGCTGCC
AGAGCTTTCTGTGCAATTTCAGTGCGGCCGATGGCGGGCTGCGGGCAAGCGTCACCCTGCTGGGTGCCGG
GCTGCTGCTGAGCCTGCTGCCGGCCCTGCTGCGGTTTGGCCCC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC211373 representing NM_002346
Red=Cloning site Green=Tags(s)

MKIFLPVLLAALLGVERASSLMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKT
CSPACPIPEGVNVGVASMGISCCQSFLCNFSAADGGLRASVTLLGAGLLLSLLPALLRFGP

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_002346
ORF Size 393 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002346.3
RefSeq Size 1194 bp
RefSeq ORF 396 bp
Locus ID 4061
UniProt ID Q16553
Cytogenetics 8q24.3
Domains LU
MW 14 kDa
Summary Involved in T-cell development. Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3:beta-4-containing nAChRs maximum response.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_002346" in other vectors (6)
SKU Description Size Price
RC211373L1 Lenti-ORF clone of LY6E (Myc-DDK-tagged)-Human lymphocyte antigen 6 complex, locus E (LY6E), transcript variant 1 10 ug
$525.00
RC211373L2 Lenti-ORF clone of LY6E (mGFP-tagged)-Human lymphocyte antigen 6 complex, locus E (LY6E), transcript variant 1 10 ug
$525.00
RC211373L3 Lenti-ORF clone of LY6E (Myc-DDK-tagged)-Human lymphocyte antigen 6 complex, locus E (LY6E), transcript variant 1 10 ug
$525.00
RC211373L4 Lenti-ORF clone of LY6E (mGFP-tagged)-Human lymphocyte antigen 6 complex, locus E (LY6E), transcript variant 1 10 ug
$525.00
RG211373 LY6E (tGFP-tagged) - Human lymphocyte antigen 6 complex, locus E (LY6E), transcript variant 1 10 ug
$489.00
SC127487 LY6E (untagged)-Human lymphocyte antigen 6 complex, locus E (LY6E), transcript variant 1 10 ug
$225.00

Plasmid Map for RC211373

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC211373
Circular map for RC211373

file-alt Citations

Ly6E/K Signaling to TGFβ Promotes Breast Cancer Progression, Immune Escape, and Drug Resistance
AlHossiny, Luo, Frazier et al
Cancer Res. (2016) 76 (11), 3376-86 DOI: 10.1158/0008-5472.CAN-15-2654
AI Summary: OriGene products contributed to this study by providing open reading frame clones of Ly6K and Ly6E, which were used for overexpression experiments to investigate their roles in breast cancer progression, immune escape, and drug resistance.
Snippet: For overexpression, the open reading frame containing clones (Ly6K, Ly6E) in G418 selection markers were obtained by Origene MD
FigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products