ASC2 (PYDC1) (NM_152901) Human Tagged ORF Clone

SKU
RC211240
PYDC1 (Myc-DDK-tagged)-Human PYD (pyrin domain) containing 1 (PYDC1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Target Symbol ASC2
Synonyms ASC2; cPOP1; POP1; PYC1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC211240 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGAACGAAGCGCGAGGCCATCCTGAAGGTGCTGGAGAACCTGACACCGGAGGAGCTCAAGAAGTTCA
AGATGAAGCTGGGGACGGTGCCGCTGCGCGAGGGCTTTGAGCGCATCCCGCGGGGCGCGCTCGGGCAGCT
AGATATCGTGGACCTCACCGACAAGCTGGTCGCCTCCTACTACGAGGACTACGCAGCCGAGCTCGTCGTG
GCCGTGCTGCGCGACATGCGCATGTTGGAGGAGGCCGCACGGCTGCAGCGGGCTGCG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC211240 protein sequence
Red=Cloning site Green=Tags(s)

MGTKREAILKVLENLTPEELKKFKMKLGTVPLREGFERIPRGALGQLDIVDLTDKLVASYYEDYAAELVV
AVLRDMRMLEEAARLQRAA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_152901
ORF Size 267 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_152901.4
RefSeq Size 582 bp
RefSeq ORF 270 bp
Locus ID 260434
UniProt ID Q8WXC3
Cytogenetics 16p11.2
Protein Pathways NOD-like receptor signaling pathway
MW 10.1 kDa
Summary Associates with PYCARD/ASC and modulates its ability to collaborate with MEFV/pyrin and NLRP3/cryopyrin in NF-kappa-B and pro-caspase-1 activation. Suppresses kinase activity of NF-kappa-B inhibitor kinase (IKK) complex, expression of NF-kappa-B inducible genes and inhibits NF-kappa-B activation by cytokines and LPS.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:ASC2 (PYDC1) (NM_152901) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC211240L3 Lenti ORF clone of Human PYD (pyrin domain) containing 1 (PYDC1), Myc-DDK-tagged 10 ug
$450.00
RC211240L4 Lenti ORF clone of Human PYD (pyrin domain) containing 1 (PYDC1), mGFP tagged 10 ug
$450.00
RG211240 PYDC1 (tGFP-tagged) - Human PYD (pyrin domain) containing 1 (PYDC1) 10 ug
$489.00
SC306521 PYDC1 (untagged)-Human PYD (pyrin domain) containing 1 (PYDC1) 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.