OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SMURF 2 (SMURF2) (NM_022739) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC210866
SMURF2 (Myc-DDK-tagged)-Human SMAD specific E3 ubiquitin protein ligase 2 (SMURF2)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $685.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "SMURF 2 or NM_022739"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SMURF 2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210866 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTAACCCCGGAGGCCGGAGGAACGGGCCCGTCAAGCTGCGCCTGACAGTACTCTGTGCAAAAAACC
TGGTGAAAAAGGATTTTTTCCGACTTCCTGATCCATTTGCTAAGGTGGTGGTTGATGGATCTGGGCAATG
CCATTCTACAGATACTGTGAAGAATACGCTTGATCCAAAGTGGAATCAGCATTATGACCTGTATATTGGA
AAGTCTGATTCAGTTACGATCAGTGTATGGAATCACAAGAAGATCCATAAGAAACAAGGTGCTGGATTTC
TCGGTTGTGTTCGTCTTCTTTCCAATGCCATCAACCGCCTCAAAGACACTGGTTATCAGAGGTTGGATTT
ATGCAAACTCGGGCCAAATGACAATGATACAGTTAGAGGACAGATAGTAGTAAGTCTTCAGTCCAGAGAC
CGAATAGGCACAGGAGGACAAGTTGTGGACTGCAGTCGTTTATTTGATAACGATTTACCAGACGGCTGGG
AAGAAAGGAGAACCGCCTCTGGAAGAATCCAGTATCTAAACCATATAACAAGAACTACGCAATGGGAGCG
CCCAACACGACCGGCATCCGAATATTCTAGCCCTGGCAGACCTCTTAGCTGCTTTGTTGATGAGAACACT
CCAATTAGTGGAACAAATGGTGCAACATGTGGACAGTCTTCAGATCCCAGGCTGGCAGAGAGGAGAGTCA
GGTCACAACGACATAGAAATTACATGAGCAGAACACATTTACATACTCCTCCAGACCTACCAGAAGGCTA
TGAACAGAGGACAACGCAACAAGGCCAGGTGTATTTCTTACATACACAGACTGGTGTGAGCACATGGCAT
GATCCAAGAGTGCCCAGGGATCTTAGCAACATCAATTGTGAAGAGCTTGGTCCATTGCCTCCTGGATGGG
AGATCCGTAATACGGCAACAGGCAGAGTTTATTTCGTTGACCATAACAACAGAACAACACAATTTACAGA
TCCTCGGCTGTCTGCTAACTTGCATTTAGTTTTAAATCGGCAGAACCAATTGAAAGACCAACAGCAACAG
CAAGTGGTATCGTTATGTCCTGATGACACAGAATGCCTGACAGTCCCAAGGTACAAGCGAGACCTGGTTC
AGAAACTAAAAATTTTGCGGCAAGAACTTTCCCAACAACAGCCTCAGGCAGGTCATTGCCGCATTGAGGT
TTCCAGGGAAGAGATTTTTGAGGAATCATATCGACAGGTCATGAAAATGAGACCAAAAGATCTCTGGAAG
CGATTAATGATAAAATTTCGTGGAGAAGAAGGCCTTGACTATGGAGGCGTTGCCAGGGAATGGTTGTATC
TCTTGTCACATGAAATGTTGAATCCATACTATGGCCTCTTCCAGTATTCAAGAGATGATATTTATACATT
GCAGATCAATCCTGATTCTGCAGTTAATCCGGAACATTTATCCTATTTCCACTTTGTTGGACGAATAATG
GGAATGGCTGTGTTTCATGGACATTATATTGATGGTGGTTTCACATTGCCTTTTTATAAGCAATTGCTTG
GGAAGTCAATTACCTTGGATGACATGGAGTTAGTAGATCCGGATCTTCACAACAGTTTAGTGTGGATACT
TGAGAATGATATTACAGGTGTTTTGGACCATACCTTCTGTGTTGAACATAATGCATATGGTGAAATTATT
CAGCATGAACTTAAACCAAATGGCAAAAGTATCCCTGTTAATGAAGAAAATAAAAAAGAATATGTCAGGC
TCTATGTGAACTGGAGATTTTTACGAGGCATTGAGGCTCAATTCTTGGCTCTGCAGAAAGGATTTAATGA
AGTAATTCCACAACATCTGCTGAAGACATTTGATGAGAAGGAGTTAGAGCTCATTATTTGTGGACTTGGA
AAGATAGATGTTAATGACTGGAAGGTAAACACCCGGTTAAAACACTGTACACCAGACAGCAACATTGTCA
AATGGTTCTGGAAAGCTGTGGAGTTTTTTGATGAAGAGCGACGAGCAAGATTGCTTCAGTTTGTGACAGG
ATCCTCTCGAGTGCCTCTGCAGGGCTTCAAAGCATTGCAAGGTGCTGCAGGCCCGAGACTCTTTACCATA
CACCAGATTGATGCCTGCACTAACAACCTGCCGAAAGCCCACACTTGCTTCAATCGAATAGACATTCCAC
CCTATGAAAGCTATGAAAAGCTATATGAAAAGCTGCTAACAGCCATTGAAGAAACATGTGGATTTGCTGT
GGAA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC210866 protein sequence
Red=Cloning site Green=Tags(s)

MSNPGGRRNGPVKLRLTVLCAKNLVKKDFFRLPDPFAKVVVDGSGQCHSTDTVKNTLDPKWNQHYDLYIG
KSDSVTISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDLCKLGPNDNDTVRGQIVVSLQSRD
RIGTGGQVVDCSRLFDNDLPDGWEERRTASGRIQYLNHITRTTQWERPTRPASEYSSPGRPLSCFVDENT
PISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWH
DPRVPRDLSNINCEELGPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQ
QVVSLCPDDTECLTVPRYKRDLVQKLKILRQELSQQQPQAGHCRIEVSREEIFEESYRQVMKMRPKDLWK
RLMIKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHLSYFHFVGRIM
GMAVFHGHYIDGGFTLPFYKQLLGKSITLDDMELVDPDLHNSLVWILENDITGVLDHTFCVEHNAYGEII
QHELKPNGKSIPVNEENKKEYVRLYVNWRFLRGIEAQFLALQKGFNEVIPQHLLKTFDEKELELIICGLG
KIDVNDWKVNTRLKHCTPDSNIVKWFWKAVEFFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTI
HQIDACTNNLPKAHTCFNRIDIPPYESYEKLYEKLLTAIEETCGFAVE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_022739
ORF Size 2244 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_022739.4
RefSeq Size 3866 bp
RefSeq ORF 2247 bp
Locus ID 64750
UniProt ID Q9HAU4, Q96DE7
Cytogenetics 17q23.3-q24.1
Domains C2, HECT, WW
Protein Families Adult stem cells, Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors
Protein Pathways Allograft rejection, Antigen processing and presentation, Autoimmune thyroid disease, Cell adhesion molecules (CAMs), Endocytosis, Graft-versus-host disease, TGF-beta signaling pathway, Type I diabetes mellitus, Ubiquitin mediated proteolysis, Viral myocarditis
MW 86.2 kDa
Summary E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Interacts with SMAD1 and SMAD7 in order to trigger their ubiquitination and proteasome-dependent degradation. In addition, interaction with SMAD7 activates autocatalytic degradation, which is prevented by interaction with SCYE1. Forms a stable complex with the TGF-beta receptor-mediated phosphorylated SMAD2 and SMAD3. In this way, SMAD2 may recruit substrates, such as SNON, for ubiquitin-mediated degradation. Enhances the inhibitory activity of SMAD7 and reduces the transcriptional activity of SMAD2. Coexpression of SMURF2 with SMAD1 results in considerable decrease in steady-state level of SMAD1 protein and a smaller decrease of SMAD2 level.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_022739" in other vectors (6)
SKU Description Size Price
RC210866L1 Lenti ORF clone of Human SMAD specific E3 ubiquitin protein ligase 2 (SMURF2), Myc-DDK-tagged 10 ug
$985.00
RC210866L2 Lenti ORF clone of Human SMAD specific E3 ubiquitin protein ligase 2 (SMURF2), mGFP tagged 10 ug
$985.00
RC210866L3 Lenti ORF clone of Human SMAD specific E3 ubiquitin protein ligase 2 (SMURF2), Myc-DDK-tagged 10 ug
$985.00
RC210866L4 Lenti ORF clone of Human SMAD specific E3 ubiquitin protein ligase 2 (SMURF2), mGFP tagged 10 ug
$985.00
RG210866 SMURF2 (tGFP-tagged) - Human SMAD specific E3 ubiquitin protein ligase 2 (SMURF2) 10 ug
$789.00 $885.00
SC112475 SMURF2 (untagged)-Human SMAD specific E3 ubiquitin protein ligase 2 (SMURF2) 10 ug
$686.00

Plasmid Map for RC210866

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC210866
Circular map for RC210866

file-alt Citations

NKL homeobox gene NKX2-2 is aberrantly expressed in Hodgkin lymphoma
Nagel, MacLeod, Pommerenke et al
Oncotarget (2018) 9 (101), 37480-37496 DOI: 10.18632/oncotarget.26459
Snippet: … Expression constructs for NKX2-2, MSX1 and SMURF2 were obtained from Origene (Wiesbaden, Germany);Expression constructs for NKX2-2, MSX1 and SMURF2 were obtained from Origene (Wiesbaden, Germany). …
FigureFigureFigure
SET9-Mediated Regulation of TGF-β Signaling Links Protein Methylation to Pulmonary Fibrosis
Elkouris, Kontaki, Stavropoulos et al
Cell Rep (2016) 15 (12), 2733-44 DOI: 10.1016/j.celrep.2016.05.051
Cited by 75
AI Summary: OriGene products contributed to this study by providing the pRS-Set9 shRNA vector used to generate Set9-depleted cell lines and the mammalian expression vectors pCMV6-RNF111 (Arkadia), pCMV6-Smurf1, and pCMV6-Smurf2 used to study the roles of these proteins in TGF-β signaling and pulmonary fibrosis.
Snippet: Sh-Set9-expressing HeLa cell line was generated by transfecting pRS-Set9 vector (OriGene) harboring the following short hairpin sequence. Mammalian expression vectors for Arkadia (pCMV6-RNF111), Smurf1 (pCMV6-Smurf1), and Smurf2 (pCMV6-Smurf2) were obtained from OriGene
The E3 ubiquitin ligase SMAD ubiquitination regulatory factor 2 negatively regulates Krüppel-like factor 5 protein
Du, Hagos, Nandan et al
J. Biol. Chem. (2011) 286 (46), 40354-64 DOI: 10.1074/jbc.M111.258707
Cited by 7
AI Summary: OriGene contributed to this study by providing a mixture of three siRNAs targeting different regions of SMURF2, which were used to knock down SMURF2 expression and assess its effect on KLF5 protein regulation.
Snippet: In contrast, knocking down SMURF2 by siRNAs significantly enhanced KLF5 protein levels, reduced ubiquitination of KLF5, and increased the ... against SMURF2, in the form of either a mixture of three siRNAs targeting different regions of SMURF2 (Origene, company-guaranteed
TRB3 interacts with SMAD3 promoting tumor cell migration and invasion
Hua, Mu, Liu et al
J. Cell. Sci. (2011) 124 (Pt 19), 3235-46 DOI: 10.1242/jcs.082875
Cited by 146
AI Summary: OriGene products contributed to this study by providing the TRB3 expression plasmid and TRB3 shRNA used for overexpression and knockdown experiments to assess the role of TRB3 in regulating SMAD3 activity and tumor cell behavior.
Snippet: Expression of exogenous TRB3 enhanced the transcriptional activity of SMAD3, whereas knocking down endogenous TRB3 reduced the transcriptional activity of SMAD3. ... Using a GST pull-down assay we detected which domain of SMAD3 interacted with TRB3.
Showing 1-4 of 4 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products