OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FNTA (NM_002027) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC210293
FNTA (Myc-DDK-tagged)-Human farnesyltransferase, CAAX box, alpha (FNTA), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "FNTA or NM_002027"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol FNTA
Synonyms FPTA; PGGT1A; PTAR2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210293 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCCACCGAGGGGGTCGGGGAGGCTGCGCAAGGGGGCGAGCCCGGGCAGCCGGCGCAACCCCCGC
CCCAGCCGCACCCACCGCCGCCCCAGCAGCAGCACAAGGAAGAGATGGCGGCCGAGGCTGGGGAAGCCGT
GGCGTCCCCCATGGACGACGGGTTTGTGAGCCTGGACTCGCCCTCCTATGTCCTGTACAGGGACAGAGCA
GAATGGGCTGATATAGATCCGGTGCCGCAGAATGATGGCCCCAATCCCGTGGTCCAGATCATTTATAGTG
ACAAATTTAGAGATGTTTATGATTACTTCCGAGCTGTCCTGCAGCGTGATGAAAGAAGTGAACGAGCTTT
TAAGCTAACCCGGGATGCTATTGAGTTAAATGCAGCCAATTATACAGTGTGGCATTTCCGGAGAGTTCTT
TTGAAGTCACTTCAGAAGGATCTACATGAGGAAATGAACTACATCACTGCAATAATTGAGGAGCAGCCCA
AAAACTATCAAGTTTGGCATCATAGGCGAGTATTAGTGGAATGGCTAAGAGATCCATCTCAGGAGCTTGA
ATTTATTGCTGATATTCTTAATCAGGATGCAAAGAATTATCATGCCTGGCAGCATCGACAATGGGTTATT
CAGGAATTTAAACTTTGGGATAATGAGCTGCAGTATGTGGACCAACTTCTGAAAGAGGATGTGAGAAATA
ACTCTGTCTGGAACCAAAGATACTTCGTTATTTCTAACACCACTGGCTACAATGATCGTGCTGTATTGGA
GAGAGAAGTCCAATACACTCTGGAAATGATTAAACTAGTACCACATAATGAAAGTGCATGGAACTATTTG
AAAGGGATTTTGCAGGATCGTGGTCTTTCCAAATATCCTAATCTGTTAAATCAATTACTTGATTTACAAC
CAAGTCATAGTTCCCCCTACCTAATTGCCTTTCTTGTGGATATCTATGAAGACATGCTAGAAAATCAGTG
TGACAATAAGGAAGACATTCTTAATAAAGCATTAGAGTTATGTGAAATCCTAGCTAAAGAAAAGGACACT
ATAAGAAAGGAATATTGGAGATACATTGGAAGATCCCTTCAAAGCAAACACAGCACAGAAAATGACTCAC
CAACAAATGTACAGCAA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC210293 protein sequence
Red=Cloning site Green=Tags(s)

MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGFVSLDSPSYVLYRDRA
EWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVL
LKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVI
QEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYL
KGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDT
IRKEYWRYIGRSLQSKHSTENDSPTNVQQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_002027
ORF Size 1137 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002027.3
RefSeq Size 1710 bp
RefSeq ORF 1140 bp
Locus ID 2339
UniProt ID P49354
Cytogenetics 8p11.21
Domains PPTA
Protein Families Druggable Genome
MW 44.4 kDa
Summary Prenyltransferases can attach either a farnesyl group or a geranylgeranyl group in thioether linkage to the cysteine residue of proteins with a C-terminal CAAX box. CAAX geranylgeranyltransferase and CAAX farnesyltransferase are heterodimers that share the same alpha subunit but have different beta subunits. This gene encodes the alpha subunit of these transferases. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 11 and 13. provided by RefSeq, May 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_002027" in other vectors (6)
SKU Description Size Price
RC210293L1 Lenti ORF clone of Human farnesyltransferase, CAAX box, alpha (FNTA), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC210293L2 Lenti ORF clone of Human farnesyltransferase, CAAX box, alpha (FNTA), transcript variant 1, mGFP tagged 10 ug
$757.00
RC210293L3 Lenti ORF clone of Human farnesyltransferase, CAAX box, alpha (FNTA), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC210293L4 Lenti ORF clone of Human farnesyltransferase, CAAX box, alpha (FNTA), transcript variant 1, mGFP tagged 10 ug
$757.00
RG210293 FNTA (tGFP-tagged) - Human farnesyltransferase, CAAX box, alpha (FNTA), transcript variant 1 10 ug
$657.00
SC118855 FNTA (untagged)-Human farnesyltransferase, CAAX box, alpha (FNTA), transcript variant 1 10 ug
$457.00

Plasmid Map for RC210293

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC210293
Circular map for RC210293

file-alt Citations

GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase
Kuchay, Wang, Marzio et al
Nat. Struct. Mol. Biol. (2019) 26 (7), 628-636 DOI: 10.1038/s41594-019-0249-3
AI Summary: OriGene products contributed human cDNA open reading frames for PTAR1, FNTA, and RabGGTA, which were used to study the components and function of the newly identified geranylgeranyltransferase GGTase3 in this paper.
Snippet: The previously unknown human prenyltransferase, GGTase3, geranylgeranylates the ubiquitin ligase FBXL2, which bears a motif predicted to be recognized by GGTase1. The structure of the GGTase3-FBXL2-SKP1 complex reveals the basis of GGTase3 substrate;Antibodies were from Abcam (FNTA, FNTB), Abnova (PGGT1B), Bethyl (RabGGTB), Aviva Biosystems (RabGGTA), Sigma (anti-FLAG M2, anti-FLAG, β-actin), Santa Cruz Biotechnology (SKP1) and Covance (anti-hemagluttinin (HA)). A polyclonal rabbit antibody to FBXL2 was generated using a peptide against FBXL2 as previously described27. Human cDNA open reading frames for PTAR1, FNTA and RabGGTA were purchased from Origene. …
WB
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products