OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BMP9 (GDF2) (NM_016204) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC210204
GDF2 (Myc-DDK-tagged)-Human growth differentiation factor 2 (GDF2)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "BMP9 or NM_016204"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol BMP9
Synonyms BMP-9; BMP9; HHT5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210204 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGTCCTGGGGCACTGTGGGTGGCCCTGCCCCTGCTGTCCCTGCTGGCTGGCTCCCTACAGGGGAAGC
CACTGCAGAGCTGGGGACGAGGGTCTGCTGGGGGAAACGCCCACAGCCCACTGGGGGTGCCTGGAGGTGG
GCTGCCTGAGCACACCTTCAACCTGAAGATGTTTCTGGAGAACGTGAAGGTGGATTTCCTGCGCAGCCTT
AACCTGAGTGGGGTCCCTTCGCAGGACAAAACCAGGGTGGAGCCGCCGCAGTACATGATTGACCTGTACA
ACAGGTACACGTCCGATAAGTCGACTACGCCAGCGTCCAACATTGTGCGGAGCTTCAGCATGGAAGATGC
CATCTCCATAACTGCCACAGAGGACTTCCCCTTCCAGAAGCACATCTTGCTCTTCAACATCTCCATTCCT
AGGCATGAGCAGATCACCAGAGCTGAGCTCCGACTCTATGTCTCCTGTCAAAATCACGTGGACCCCTCTC
ATGACCTGAAAGGAAGCGTGGTCATTTATGATGTTCTGGATGGAACAGATGCCTGGGATAGTGCTACAGA
GACCAAGACCTTCCTGGTGTCCCAGGACATTCAGGATGAGGGCTGGGAGACCTTGGAAGTGTCCAGCGCC
GTGAAGCGCTGGGTCCGGTCCGACTCCACCAAGAGCAAAAATAAGCTGGAAGTGACTGTGGAGAGCCACA
GGAAGGGCTGCGACACGCTGGACATCAGTGTCCCCCCAGGTTCCAGAAACCTGCCCTTCTTTGTTGTCTT
CTCCAATGACCACAGCAGTGGGACCAAGGAGACCAGGCTGGAGCTGAGGGAGATGATCAGCCATGAACAA
GAGAGCGTGCTCAAGAAGCTGTCCAAGGACGGCTCCACAGAGGCAGGTGAGAGCAGTCACGAGGAGGACA
CGGATGGCCACGTGGCTGCGGGGTCGACTTTAGCCAGGCGGAAAAGGAGCGCCGGGGCTGGCAGCCACTG
TCAAAAGACCTCCCTGCGGGTAAACTTCGAGGACATCGGCTGGGACAGCTGGATCATTGCACCCAAGGAG
TATGAAGCCTACGAGTGTAAGGGCGGCTGCTTCTTCCCCTTGGCTGACGATGTGACGCCGACGAAACACG
CTATCGTGCAGACCCTGGTGCATCTCAAGTTCCCCACAAAGGTGGGCAAGGCCTGCTGTGTGCCCACCAA
ACTGAGCCCCATCTCCGTCCTCTACAAGGATGACATGGGGGTGCCCACCCTCAAGTACCATTACGAGGGC
ATGAGCGTGGCAGAGTGTGGGTGCAGG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC210204 protein sequence
Red=Cloning site Green=Tags(s)

MCPGALWVALPLLSLLAGSLQGKPLQSWGRGSAGGNAHSPLGVPGGGLPEHTFNLKMFLENVKVDFLRSL
NLSGVPSQDKTRVEPPQYMIDLYNRYTSDKSTTPASNIVRSFSMEDAISITATEDFPFQKHILLFNISIP
RHEQITRAELRLYVSCQNHVDPSHDLKGSVVIYDVLDGTDAWDSATETKTFLVSQDIQDEGWETLEVSSA
VKRWVRSDSTKSKNKLEVTVESHRKGCDTLDISVPPGSRNLPFFVVFSNDHSSGTKETRLELREMISHEQ
ESVLKKLSKDGSTEAGESSHEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKE
YEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEG
MSVAECGCR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_016204
ORF Size 1287 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016204.4
RefSeq Size 1955 bp
RefSeq ORF 1290 bp
Locus ID 2658
UniProt ID Q9UK05
Cytogenetics 10q11.22
Protein Families Druggable Genome, Secreted Protein
MW 47.3 kDa
Summary This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein regulates cartilage and bone development, angiogenesis and differentiation of cholinergic central nervous system neurons. Mutations in this gene are associated with hereditary hemorrhagic telangiectasia. provided by RefSeq, Jul 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_016204" in other vectors (6)
SKU Description Size Price
RC210204L1 Lenti ORF clone of Human growth differentiation factor 2 (GDF2), Myc-DDK-tagged 10 ug
$757.00
RC210204L2 Lenti ORF clone of Human growth differentiation factor 2 (GDF2), mGFP tagged 10 ug
$757.00
RC210204L3 Lenti ORF clone of Human growth differentiation factor 2 (GDF2), Myc-DDK-tagged 10 ug
$757.00
RC210204L4 Lenti ORF clone of Human growth differentiation factor 2 (GDF2), mGFP tagged 10 ug
$757.00
RG210204 GDF2 (tGFP-tagged) - Human growth differentiation factor 2 (GDF2) 10 ug
$489.00 $657.00
SC304392 GDF2 (untagged)-Human growth differentiation factor 2 (GDF2) 10 ug
$457.00

Plasmid Map for RC210204

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC210204
Circular map for RC210204

file-alt Citations

A bioactive collagen membrane that enhances bone regeneration
Khorsand, Elangovan, Hong et al
J. Biomed. Mater. Res. Part B Appl. Biomater. (2018)
AI Summary: OriGene Technologies supplied the plasmid DNA encoding human BMP-9, which was incorporated into collagen membranes to enhance bone regeneration in this study.
Snippet: (St. Louis, MO). Plasmid DNA encoding human BMP-9 (ORF size 1290 bp) possessing a cytomegalovirus promoter/ enhancer was provided by Origene Technologies, Inc. (Rockville, MD). PolyA-120 containing T7 pVAX1 was pro- vided by Life Technologies (Madison
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products