OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Mannan Binding Lectin (MBL2) (NM_000242) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC210143
MBL2 (Myc-DDK-tagged)-Human mannose-binding lectin (protein C) 2, soluble (MBL2)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA507147 MBL2 mouse monoclonal antibody, clone OTI1A12 (formerly 1A12) 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Mannan Binding Lectin or NM_000242"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Mannan Binding Lectin
Synonyms COLEC1; HSMBPC; MBL; MBL2D; MBP; MBP-C; MBP1; MBPD
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210143 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCCTGTTTCCATCACTCCCTCTCCTTCTCCTGAGTATGGTGGCAGCGTCTTACTCAGAAACTGTGA
CCTGTGAGGATGCCCAAAAGACCTGCCCTGCAGTGATTGCCTGTAGCTCTCCAGGCATCAACGGCTTCCC
AGGCAAAGATGGGCGTGATGGCACCAAGGGAGAAAAGGGGGAACCAGGCCAAGGGCTCAGAGGCTTACAG
GGCCCCCCTGGAAAGTTGGGGCCTCCAGGAAATCCAGGGCCTTCTGGGTCACCAGGACCAAAGGGCCAAA
AAGGAGACCCTGGAAAAAGTCCGGATGGTGATAGTAGCCTGGCTGCCTCAGAAAGAAAAGCTCTGCAAAC
AGAAATGGCACGTATCAAAAAGTGGCTCACCTTCTCTCTGGGCAAACAAGTTGGGAACAAGTTCTTCCTG
ACCAATGGTGAAATAATGACCTTTGAAAAAGTGAAGGCCTTGTGTGTCAAGTTCCAGGCCTCTGTGGCCA
CCCCCAGGAATGCTGCAGAGAATGGAGCCATTCAGAATCTCATCAAGGAGGAAGCCTTCCTGGGCATCAC
TGATGAGAAGACAGAAGGGCAGTTTGTGGATCTGACAGGAAATAGACTGACCTACACAAACTGGAACGAG
GGTGAACCCAACAATGCTGGTTCTGATGAAGATTGTGTATTGCTACTGAAAAATGGCCAGTGGAATGACG
TCCCCTGCTCCACCTCCCATCTGGCCGTCTGTGAGTTCCCTATC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC210143 protein sequence
Red=Cloning site Green=Tags(s)

MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQ
GPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFL
TNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNE
GEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_000242
ORF Size 744 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000242.3
RefSeq Size 3569 bp
RefSeq ORF 747 bp
Locus ID 4153
UniProt ID P11226
Cytogenetics 10q21.1
Protein Families Druggable Genome
Protein Pathways Complement and coagulation cascades
MW 26.1 kDa
Summary This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognizes and binds to mannose and N-acetylglucosamine on many microorganisms, including bacteria, yeast, and viruses including influenza virus, HIV and SARS-CoV. This binding activates the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases. provided by RefSeq, Jun 2020
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_000242" in other vectors (4)
SKU Description Size Price
RC210143L3 Lenti ORF clone of Human mannose-binding lectin (protein C) 2, soluble (MBL2), Myc-DDK-tagged 10 ug
$600.00
RC210143L4 Lenti ORF clone of Human mannose-binding lectin (protein C) 2, soluble (MBL2), mGFP tagged 10 ug
$600.00
RG210143 MBL2 (tGFP-tagged) - Human mannose-binding lectin (protein C) 2, soluble (MBL2) 10 ug
$489.00 $500.00
SC300032 MBL2 (untagged)-Human mannose-binding lectin (protein C) 2, soluble (MBL2) 10 ug
$300.00

Plasmid Map for RC210143

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC210143
Circular map for RC210143

file-alt Citations

Mannose Binding Lectin Is Hydroxylated by Collagen Prolyl-4-hydroxylase and Inhibited by Some PHD Inhibitors
Bhute, Harte, Houghton et al
Kidney360 (2020) 1 (6), 447-457 DOI: 10.34067/KID.0000092020
AI Summary: In this study, OriGene’s Myc-DDK tagged MBL expression plasmid was used to stably express mannose-binding lectin in HEK293S cells, enabling the investigation of prolyl hydroxylation and its regulation by prolyl-4-hydroxylase and PHD inhibitors.
Mannose binding lectin is hydroxylated by collagen prolyl-4-hydroxylase and inhibited by some PHD inhibitors
Bhute, Harte, Houghton et al
Kidney360 (2020)
AI Summary: OriGene products contributed to this study by providing the Myc-DDK tagged MBL plasmid (Cat# RC210143) and the transfection reagent Turbofectin 8.0 (Cat# TF81001), which were used to express MBL in HEK293S cells for investigating its post-translational modifications.
Snippet: NM_000242) tagged with Myc-DDK (Cat# RC210143) and the transfection reagent, Turbofectin 8.0 (Cat# TF81001), were purchased from OriGene Technologies Inc. Approximately 24 hours before transfection, ~105 cells were plated in each;- NM_000242) tagged with Myc-DDK (Cat# RC210143) and the transfection reagent, Turbofectin 8.0 (Cat# TF81001), were purchased from OriGene Technologies Inc. …
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products