OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CER1 (NM_005454) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC210111
CER1 (Myc-DDK-tagged) - Human cerberus 1, DAN family BMP antagonist (CER1)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA365629 CER1 rabbit polyclonal antibody
100 ul
$310.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "CER1 or NM_005454"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CER1
Synonyms DAND4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210111 representing NM_005454.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGCATCTCCTCTTATTTCAGCTGCTGGTACTCCTGCCTCTAGGAAAGACCACACGGCACCAGGATGGC
CGCCAGAATCAGAGTTCTCTTTCCCCCGTACTCCTGCCAAGGAATCAAAGAGAGCTTCCCACAGGCAAC
CATGAGGAAGCTGAGGAGAAGCCAGATCTGTTTGTCGCAGTGCCACACCTTGTAGGCACCAGCCCTGCA
GGGGAAGGCCAGAGGCAGAGAGAGAAGATGCTGTCCAGATTTGGCAGGTTCTGGAAGAAGCCTGAGAGA
GAAATGCATCCATCCAGGGACTCAGATAGTGAGCCCTTCCCACCTGGGACCCAGTCCCTCATCCAGCCG
ATAGATGGAATGAAAATGGAGAAATCTCCTCTTCGGGAAGAAGCCAAGAAATTCTGGCACCACTTCATG
TTCAGAAAAACTCCGGCTTCTCAGGGGGTCATCTTGCCCATCAAAAGCCATGAAGTACATTGGGAGACC
TGCAGGACAGTGCCCTTCAGCCAGACTATAACCCACGAAGGCTGTGAGAAAGTAGTTGTTCAGAACAAC
CTTTGCTTTGGGAAATGCGGGTCTGTTCATTTTCCTGGAGCCGCGCAGCACTCCCATACCTCCTGCTCT
CACTGTTTGCCTGCCAAGTTCACCACGATGCACTTGCCAGTGAACTGCACTGAACTTTCCTCCGTGATC
AAGGTGGTGATGCTGGTGGAGGAGTGCCAGTGCAAGGTGAAGACGGAGCATGAAGATGGACACATCCTA
CATGCTGGCTCCCAGGATTCCTTTATCCCAGGAGTTTCAGCT
ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGAT
TACAAGGATGACGACGATAAGGTTTAAACGGCCGGC
Protein Sequence
>Peptide sequence encoded by RC210111
Blue=ORF Red=Cloning site Green=Tag(s)

MHLLLFQLLVLLPLGKTTRHQDGRQNQSSLSPVLLPRNQRELPTGNHEEAEEKPDLFVAVPHLVGTSPA
GEGQRQREKMLSRFGRFWKKPEREMHPSRDSDSEPFPPGTQSLIQPIDGMKMEKSPLREEAKKFWHHFM
FRKTPASQGVILPIKSHEVHWETCRTVPFSQTITHEGCEKVVVQNNLCFGKCGSVHFPGAAQHSHTSCS
HCLPAKFTTMHLPVNCTELSSVIKVVMLVEECQCKVKTEHEDGHILHAGSQDSFIPGVSA
myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_005454
ORF Size 801 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq Size 1206 bp
RefSeq ORF 804 bp
Locus ID 9350
UniProt ID O95813
Cytogenetics 9p22.3
Protein Families Secreted Protein
Protein Pathways Wnt signaling pathway
MW 30.1 kDa
Summary This gene encodes a cytokine member of the cysteine knot superfamily, characterized by nine conserved cysteines and a cysteine knot region. The cerberus-related cytokines, together with Dan and DRM/Gremlin, represent a group of bone morphogenetic protein (BMP) antagonists that can bind directly to BMPs and inhibit their activity. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_005454" in other vectors (4)
SKU Description Size Price
RC210111L3 Lenti ORF clone of Human cerberus 1, DAN family BMP antagonist (CER1), Myc-DDK-tagged 10 ug
$600.00
RC210111L4 Lenti ORF clone of Human cerberus 1, DAN family BMP antagonist (CER1), mGFP tagged 10 ug
$600.00
RG210111 CER1 (tGFP-tagged) - Human cerberus 1, DAN family BMP antagonist (CER1), mGFP tagged 10 ug
$500.00
SC303647 CER1 (untagged) - Human cerberus 1, DAN family BMP antagonist (CER1) 10 ug
$300.00

Plasmid Map for RC210111

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC210111
Circular map for RC210111

file-alt Citations

A selective inhibitor of ceramide synthase 1 reveals a novel role in fat metabolism
Turner, Lim, Toop et al
Nat Commun (2018) 9 (1), 3165 DOI: 10.1038/s41467-018-05613-7
AI Summary: OriGene’s pCMV6 human CerS expression plasmids were used to transfect cells and enable the study of ceramide synthase isoforms, facilitating the characterization of the selective CerS1 inhibitor described in the paper.
Snippet: n CerS1, 2, and 6;U251 cells expressing human CerS4 (which did not express well in HEK293 cells);and COS cells expressing murine CerS1, 2, and 5. … n CerS1, 2, and 6
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products