OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

p21 ARC (ARPC3) (NM_005719) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC209711
ARPC3 (Myc-DDK-tagged)-Human actin related protein 2/3 complex, subunit 3, 21kDa (ARPC3)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA373695 ARPC3 Rabbit polyclonal Antibody
100 ul
$410.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "p21 ARC or NM_005719"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol p21 ARC
Synonyms ARC21; p21-Arc
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC209711 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGGCTTACCACTCTTCTCTCATGGATCCTGATACCAAACTCATCGGAAACATGGCACTGTTGCCTA
TCAGAAGTCAATTCAAAGGACCTGCCCCCAGAGAGACAAAAGATACAGATATTGTGGATGAAGCCATCTA
TTACTTCAAGGCCAATGTCTTCTTCAAAAACTATGAAATTAAGAATGAAGCTGATAGGACCTTGATATAT
ATAACTCTCTACATTTCTGAATGTCTGAAGAAACTGCAAAAGTGCAATTCCAAAAGCCAAGGTGAGAAAG
AAATGTATACGCTGGGAATCACTAATTTTCCCATTCCTGGAGAGCCTGGTTTTCCACTTAACGCAATTTA
TGCCAAACCTGCAAACAAACAGGAAGATGAAGTGATGAGAGCCTATTTACAACAGCTAAGGCAAGAGACT
GGACTGAGACTTTGTGAGAAAGTTTTCGACCCTCAGAATGATAAACCCAGCAAGTGGTGGACTTGCTTTG
TGAAGAGACAGTTCATGAACAAGAGTCTTTCAGGACCTGGACAG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC209711 protein sequence
Red=Cloning site Green=Tags(s)

MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIY
ITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQET
GLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_005719
ORF Size 534 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005719.2, NP_005710.1
RefSeq Size 962 bp
RefSeq ORF 536 bp
Locus ID 10094
Cytogenetics 12q24.11
Domains P21-Arc
Protein Pathways Fc gamma R-mediated phagocytosis, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton
MW 20.5 kDa
Summary This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been conserved through evolution and is implicated in the control of actin polymerization in cells. Alternatively spliced transcript variants have been found for this gene. provided by RefSeq, Dec 2013
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_005719" in other vectors (6)
SKU Description Size Price
RC209711L1 Lenti ORF clone of Human actin related protein 2/3 complex, subunit 3, 21kDa (ARPC3), Myc-DDK-tagged 10 ug
$600.00
RC209711L2 Lenti ORF clone of Human actin related protein 2/3 complex, subunit 3, 21kDa (ARPC3), mGFP tagged 10 ug
$600.00
RC209711L3 Lenti ORF clone of Human actin related protein 2/3 complex, subunit 3, 21kDa (ARPC3), Myc-DDK-tagged 10 ug
$600.00
RC209711L4 Lenti ORF clone of Human actin related protein 2/3 complex, subunit 3, 21kDa (ARPC3), mGFP tagged 10 ug
$600.00
RG209711 ARPC3 (tGFP-tagged) - Human actin related protein 2/3 complex, subunit 3, 21kDa (ARPC3) 10 ug
$489.00 $500.00
SC112684 ARPC3 (untagged)-Human actin related protein 2/3 complex, subunit 3, 21kDa (ARPC3) 10 ug
$300.00

Plasmid Map for RC209711

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC209711
Circular map for RC209711

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products