OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GTF2H3 (NM_001516) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC209399
GTF2H3 (Myc-DDK-tagged)-Human general transcription factor IIH, polypeptide 3, 34kDa (GTF2H3)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA812723 GTF2H3 mouse monoclonal antibody,clone OTI4B5 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "GTF2H3 or NM_001516"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GTF2H3
Synonyms BTF2; P34; TFB4; TFIIH
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC209399 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTTTCAGACGAAGATGAATTGAATCTTCTGGTTATTGTAGTTGATGCCAACCCAATTTGGTGGGGAA
AGCAAGCATTAAAGGAATCTCAGTTCACTTTATCCAAATGCATAGATGCCGTGATGGTGCTGGGAAATTC
GCATTTATTCATGAATCGTTCCAACAAACTTGCTGTGATAGCAAGTCACATTCAAGAAAGCCGATTCTTA
TATCCTGGAAAGAATGGCAGACTTGGAGACTTCTTCGGAGACCCTGGCAACCCTCCTGAATTTAATCCCT
CTGGGAGTAAAGATGGAAAATACGAACTTTTAACCTCAGCAAATGAAGTTATTGTTGAAGAGATTAAAGA
TCTAATGACCAAAAGTGACATAAAGGGTCAACATACAGAAACTTTGCTGGCAGGATCCCTGGCCAAAGCC
CTTTGCTACATTCATAGAATGAACAAGGAAGTTAAAGACAATCAGGAAATGAAATCAAGGATATTGGTGA
TTAAGGCTGCAGAAGACAGTGCGTTGCAGTATATGAACTTCATGAATGTCATCTTTGCAGCACAGAAACA
GAATATTTTGATTGATGCCTGTGTTTTAGACTCCGACTCAGGGCTCCTCCAACAGGCTTGTGACATCACG
GGAGGACTGTACCTGAAGGTGCCTCAGATGCCTTCTCTTCTGCAGTATTTGCTGTGGGTGTTTCTTCCCG
ATCAAGATCAGAGATCTCAGTTAATCCTCCCACCCCCGGTTCATGTTGACTACAGGGCTGCTTGCTTCTG
TCATCGAAATCTCATTGAAATTGGTTATGTCTGTTCTGTGTGTTTGTCAATATTCTGCAATTTCAGCCCC
ATTTGTACTACGTGCGAGACAGCCTTTAAAATTTCTCTGCCTCCAGTGCTGAAAGCCAAGAAAAAGAAAC
TGAAAGTGTCTGCC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC209399 protein sequence
Red=Cloning site Green=Tags(s)

MVSDEDELNLLVIVVDANPIWWGKQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVIASHIQESRFL
YPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSANEVIVEEIKDLMTKSDIKGQHTETLLAGSLAKA
LCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILIDACVLDSDSGLLQQACDIT
GGLYLKVPQMPSLLQYLLWVFLPDQDQRSQLILPPPVHVDYRAACFCHRNLIEIGYVCSVCLSIFCNFSP
ICTTCETAFKISLPPVLKAKKKKLKVSA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001516
ORF Size 924 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001516.2
RefSeq Size 3434 bp
RefSeq ORF 927 bp
Locus ID 2967
UniProt ID Q13889
Cytogenetics 12q24.31
Domains Tfb4
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Basal transcription factors, Nucleotide excision repair
MW 34.4 kDa
Summary This gene encodes a member of the TFB4 family. The encoded protein is a subunit of the core-TFIIH basal transcription factor and localizes to the nucleus. The encoded protein is involved in RNA transcription by RNA polymerase II and nucleotide excision repair and associates with the Cdk-activating kinase complex. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 14. provided by RefSeq, Dec 2012
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001516" in other vectors (7)
SKU Description Size Price
RC209399L1 Lenti ORF clone of Human general transcription factor IIH, polypeptide 3, 34kDa (GTF2H3), Myc-DDK-tagged 10 ug
$600.00
RC209399L2 Lenti ORF clone of Human general transcription factor IIH, polypeptide 3, 34kDa (GTF2H3), mGFP tagged 10 ug
$600.00
RC209399L3 Lenti ORF clone of Human general transcription factor IIH, polypeptide 3, 34kDa (GTF2H3), Myc-DDK-tagged 10 ug
$600.00
RC209399L4 Lenti ORF clone of Human general transcription factor IIH, polypeptide 3, 34kDa (GTF2H3), mGFP tagged 10 ug
$600.00
RG209399 GTF2H3 (tGFP-tagged) - Human general transcription factor IIH, polypeptide 3, 34kDa (GTF2H3) 10 ug
$489.00 $500.00
SC119181 GTF2H3 (untagged)-Human general transcription factor IIH, polypeptide 3, 34kDa (GTF2H3) 10 ug
$300.00
SC321954 GTF2H3 (untagged)-Human general transcription factor IIH, polypeptide 3, 34kDa (GTF2H3) 10 ug
$300.00

Plasmid Map for RC209399

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC209399
Circular map for RC209399

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products