OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GIMAP6 (NM_024711) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RC209164
GIMAP6 (Myc-DDK-tagged)-Human GTPase, IMAP family member 6 (GIMAP6), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA335463 Rabbit Polyclonal Anti-GIMAP6 Antibody
100 ul
$575.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "GIMAP6 or NM_024711"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GIMAP6
Synonyms IAN-2; IAN-6; IAN2; IAN6
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC209164 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGAAGAAGAATATGAACAAATTCCCCAGGAGAATCCCCCAGAAGAGCTGTCCCAGGATCCTGTGC
TGGAGCTGTCAGGAGGTCTAAGGGAGAAAGAACAGAAGACCCCAAGGAGACTGAGGCTCATTCTCATGGG
GAAAACAGGGAGTGGGAAGAGTGCAACAGGAAACAGCATCCTCGGCAGGGACGTCTTCGAGTCTAAACTC
AGCACCAGACCCGTGACCAAGACCTCCCAGAGACGGAGCCGAGAGTGGGCTGGGAAGGAGCTTGAGGTGA
TTGACACACCCAACATTCTGTCCCCCCAGGTCTCGCCAGAGGTGGCAGACGCTATCTGCCAAGCCATCGT
CTTATCCGCCCCAGGGCCCCACGCCGTGCTCCTGGTGACACAACTGGGCCGGTTCACGGATGAGGATCAG
CAGGTGGTCAGGCGCCTGCAGGAGGTCTTTGGAGTGGGGGTTCTGGGTCACACCATCCTGGTGTTCACCC
GGAAGGAAGACCTGGCTGGCGGCTCCCTGGAAGACTATGTGCGAGAGACCAACAACCAGGCCCTTGCCTG
GCTGGATGTGACCCTTGCACGGCGCCATTGCGGCTTCAACAACAGGGCACAGGGGGAGGAGCAGGAGGCC
CAACTGCGAGAGCTCATGGAGAAAGTTGAAGCCATTATGTGGGAAAACGAAGGAGATTATTACAGCAACA
AGGCTTACCAATATACCCAGCAAAACTTTCGGCTGAAAGAACTACAGGAAAGGCAAGTAAGCCAGGGCCA
AGGCTCTGAGGACGTGCCTGGTGAGGAGTCTTGGCTGGAAGGACTGTCCCAGATCCAGAAGGAATCTGAG
GAAGCCCACAGATGCCTGCTGGGGAAGGCTGACCTT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC209164 protein sequence
Red=Cloning site Green=Tags(s)

MEEEEYEQIPQENPPEELSQDPVLELSGGLREKEQKTPRRLRLILMGKTGSGKSATGNSILGRDVFESKL
STRPVTKTSQRRSREWAGKELEVIDTPNILSPQVSPEVADAICQAIVLSAPGPHAVLLVTQLGRFTDEDQ
QVVRRLQEVFGVGVLGHTILVFTRKEDLAGGSLEDYVRETNNQALAWLDVTLARRHCGFNNRAQGEEQEA
QLRELMEKVEAIMWENEGDYYSNKAYQYTQQNFRLKELQERQVSQGQGSEDVPGEESWLEGLSQIQKESE
EAHRCLLGKADL

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_024711
ORF Size 876 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_024711.6
RefSeq Size 3716 bp
RefSeq ORF 879 bp
Locus ID 474344
UniProt ID Q6P9H5
Cytogenetics 7q36.1
Domains AIG1
MW 32.9 kDa
Summary This gene encodes a member of the GTPases of immunity-associated proteins (GIMAP) family. GIMAP proteins contain GTP-binding and coiled-coil motifs, and may play roles in the regulation of cell survival. Decreased expression of this gene may play a role in non-small cell lung cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, which is found in a cluster with seven additional GIMAP genes on the long arm of chromosome 7. provided by RefSeq, Sep 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_024711" in other vectors (5)
SKU Description Size Price
RC209164L3 Lenti-ORF clone of GIMAP6 (Myc-DDK-tagged)-Human GTPase, IMAP family member 6 (GIMAP6), transcript variant 1 10 ug
$600.00
RC209164L4 Lenti-ORF clone of GIMAP6 (mGFP-tagged)-Human GTPase, IMAP family member 6 (GIMAP6), transcript variant 1 10 ug
$600.00
RG209164 GIMAP6 (tGFP-tagged) - Human GTPase, IMAP family member 6 (GIMAP6), transcript variant 1 10 ug
$500.00
SC112090 GIMAP6 (untagged)-Human GTPase, IMAP family member 6 (GIMAP6), transcript variant 1 10 ug
$300.00
SC317425 GIMAP6 (untagged)-Human GTPase, IMAP family member 6 (GIMAP6), transcript variant 1 10 ug
$330.00

Plasmid Map for RC209164

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC209164
Circular map for RC209164

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products