OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EMP1 (NM_001423) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC208410
EMP1 (Myc-DDK-tagged)-Human epithelial membrane protein 1 (EMP1)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $150.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA367650 EMP1 rabbit polyclonal antibody
100 ul
$310.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "EMP1 or NM_001423"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol EMP1
Synonyms CL-20; EMP-1; TMP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC208410 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGGTATTGCTGGCTGGTATCTTTGTGGTCCACATCGCTACTGTTATTATGCTATTTGTTAGCACCA
TTGCCAATGTCTGGTTGGTTTCCAATACGGTAGATGCATCAGTAGGTCTTTGGAAAAACTGTACCAACAT
TAGCTGCAGTGACAGCCTGTCATATGCCAGTGAAGATGCCCTCAAGACAGTGCAGGCCTTCATGATTCTC
TCTATCATCTTCTGTGTCATTGCCCTCCTGGTCTTCGTGTTCCAGCTCTTCACCATGGAGAAGGGAAACC
GGTTCTTCCTCTCAGGGGCCACCACACTGGTGTGCTGGCTGTGCATTCTTGTGGGGGTGTCCATCTACAC
TAGTCATTATGCGAATCGTGATGGAACGCAGTATCACCACGGCTATTCCTACATCCTGGGCTGGATCTGC
TTCTGCTTCAGCTTCATCATCGGCGTTCTCTATCTGGTCCTGAGAAAGAAA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC208410 protein sequence
Red=Cloning site Green=Tags(s)

MLVLLAGIFVVHIATVIMLFVSTIANVWLVSNTVDASVGLWKNCTNISCSDSLSYASEDALKTVQAFMIL
SIIFCVIALLVFVFQLFTMEKGNRFFLSGATTLVCWLCILVGVSIYTSHYANRDGTQYHHGYSYILGWIC
FCFSFIIGVLYLVLRKK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001423
ORF Size 471 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001423.3
RefSeq Size 2804 bp
RefSeq ORF 474 bp
Locus ID 2012
UniProt ID P54849, A0A024RAT0
Cytogenetics 12p13.1
Domains PMP22_Claudin
Protein Families Transmembrane
MW 17.6 kDa
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001423" in other vectors (6)
SKU Description Size Price
RC208410L1 Lenti ORF clone of Human epithelial membrane protein 1 (EMP1), Myc-DDK-tagged 10 ug
$450.00
RC208410L2 Lenti ORF clone of Human epithelial membrane protein 1 (EMP1), mGFP tagged 10 ug
$450.00
RC208410L3 Lenti ORF clone of Human epithelial membrane protein 1 (EMP1), Myc-DDK-tagged 10 ug
$450.00
RC208410L4 Lenti ORF clone of Human epithelial membrane protein 1 (EMP1), mGFP tagged 10 ug
$450.00
RG208410 EMP1 (tGFP-tagged) - Human epithelial membrane protein 1 (EMP1) 10 ug
$489.00
SC119245 EMP1 (untagged)-Human epithelial membrane protein 1 (EMP1) 10 ug
$150.00

Plasmid Map for RC208410

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC208410
Circular map for RC208410

file-alt Citations

p53, miR-34a and EMP1-Newly Identified Targets of TFF3 Signaling in Y79 Retinoblastoma Cells
Busch, Klein, Große-Kreul et al
Int J Mol Sci (2019) 20 (17) DOI: 10.3390/ijms20174129
AI Summary: OriGene's RC208410 vector, containing human EMP1 cDNA, was used to generate a lentiviral EMP1 expression construct, enabling the study of EMP1's role in TFF3 signaling in Y79 retinoblastoma cells.
Snippet: To generate a lentiviral EMP1 expression vector (pLenti CMV_EMP1), the human EMP1 cDNA sequence was amplified from the RC208410 vector (Origene) using the forward primer 5′-CGAATTCTATGTTGGTATTGCTGGCTGG-3′ and the reverse primer 5′-CG Cached
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products