OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ARPC1A (NM_006409) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC208053
ARPC1A (Myc-DDK-tagged)-Human actin related protein 2/3 complex, subunit 1A, 41kDa (ARPC1A), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA324845 ARPC1A Antibody (C-term)
400 ul
$645.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "ARPC1A or NM_006409"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ARPC1A
Synonyms Arc40; HEL-68; HEL-S-307; SOP2Hs; SOP2L
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC208053 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCACTGCATCAGTTTTTACTAGAGCCAATCACCTGTCATGCCTGGAACAGGGATCGTACTCAGATTG
CCCTCAGTCCCAATAATCACGAAGTGCACATCTATAAGAAGAACGGGAGCCAGTGGGTGAAAGCTCATGA
ACTCAAGGAGCACAACGGACACATCACAGGTATTGACTGGGCTCCCAAGAGCGACCGCATTGTCACTTGT
GGGGCAGACCGCAATGCCTATGTCTGGAGTCAGAAAGATGGTGTTTGGAAGCCAACCCTGGTGATCCTGA
GAATTAATCGCGCAGCTACTTTTGTGAAGTGGTCCCCCCTAGAGAACAAATTTGCTGTGGGAAGTGGAGC
ACGACTCATTTCTGTTTGTTACTTTGAGTCTGAAAATGACTGGTGGGTGAGCAAGCACATTAAAAAGCCG
ATTCGCTCCACAGTCCTCAGCTTGGATTGGCATCCCAACAACGTTTTGCTGGCAGCAGGATCATGTGACT
TCAAATGCAGAGTGTTTTCTGCCTACATTAAAGAAGTGGATGAAAAGCCAGCCAGCACGCCCTGGGGCAG
CAAGATGCCTTTTGGGCAGCTGATGTCAGAGTTTGGTGGCAGTGGCACTGGTGGCTGGGTCCACGGGGTA
AGCTTCTCTGCCAGTGGGAGCCGCCTGGCCTGGGTCAGCCACGACAGCACCGTGTCTGTTGCTGATGCCT
CAAAAAGTGTGCAGGTCTCGACTCTGAAGACAGAGTTCCTGCCGCTCCTAAGTGTGTCATTTGTCTCAGA
GAACAGCGTCGTGGCTGCTGGCCATGACTGCTGCCCAATGCTCTTTAACTACGATGACCGCGGCTGCCTG
ACCTTCGTCTCCAAGTTAGATATTCCAAAACAGAGCATCCAACGCAACATGTCTGCCATGGAACGCTTCC
GCAACATGGACAAGAGAGCCACAACTGAGGACCGCAACACGGCCTTGGAGACGCTGCACCAGAATAGCAT
CACTCAAGTCTCTATTTATGAGGTGGACAAGCAAGATTGTCGCAAATTTTGCACTACTGGCATCGATGGA
GCCATGACAATTTGGGATTTCAAGACCCTCGAGTCTTCCATCCAGGGCCTCCGGATAATG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC208053 protein sequence
Red=Cloning site Green=Tags(s)

MSLHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKKNGSQWVKAHELKEHNGHITGIDWAPKSDRIVTC
GADRNAYVWSQKDGVWKPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFESENDWWVSKHIKKP
IRSTVLSLDWHPNNVLLAAGSCDFKCRVFSAYIKEVDEKPASTPWGSKMPFGQLMSEFGGSGTGGWVHGV
SFSASGSRLAWVSHDSTVSVADASKSVQVSTLKTEFLPLLSVSFVSENSVVAAGHDCCPMLFNYDDRGCL
TFVSKLDIPKQSIQRNMSAMERFRNMDKRATTEDRNTALETLHQNSITQVSIYEVDKQDCRKFCTTGIDG
AMTIWDFKTLESSIQGLRIM

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_006409
ORF Size 1110 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006409.4
RefSeq Size 1623 bp
RefSeq ORF 1113 bp
Locus ID 10552
UniProt ID Q92747, V9HVZ6
Cytogenetics 7q22.1
Domains WD40
Protein Pathways Fc gamma R-mediated phagocytosis, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton
MW 41.6 kDa
Summary This gene encodes one of seven subunits of the human Arp2/3 protein complex. This subunit is a member of the SOP2 family of proteins and is most similar to the protein encoded by gene ARPC1B. The similarity between these two proteins suggests that they both may function as p41 subunit of the human Arp2/3 complex that has been implicated in the control of actin polymerization in cells. It is possible that the p41 subunit is involved in assembling and maintaining the structure of the Arp2/3 complex. Multiple versions of the p41 subunit may adapt the functions of the complex to different cell types or developmental stages. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jul 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_006409" in other vectors (5)
SKU Description Size Price
RC208053L3 Lenti ORF clone of Human actin related protein 2/3 complex, subunit 1A, 41kDa (ARPC1A), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC208053L4 Lenti ORF clone of Human actin related protein 2/3 complex, subunit 1A, 41kDa (ARPC1A), transcript variant 1, mGFP tagged 10 ug
$757.00
RG208053 ARPC1A (tGFP-tagged) - Human actin related protein 2/3 complex, subunit 1A, 41kDa (ARPC1A), transcript variant 1 10 ug
$489.00 $657.00
SC116099 ARPC1A (untagged)-Human actin related protein 2/3 complex, subunit 1A, 41kDa (ARPC1A), transcript variant 1 10 ug
$457.00
SC324215 ARPC1A (untagged)-Human actin related protein 2/3 complex, subunit 1A, 41kDa (ARPC1A), transcript variant 1 10 ug
$457.00

Plasmid Map for RC208053

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC208053
Circular map for RC208053

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products