OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Neuroglobin (NGB) (NM_021257) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC207482
NGB (Myc-DDK-tagged)-Human neuroglobin (NGB)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $150.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA349412 Rabbit Polyclonal Anti-NGB Antibody
100 ul
$205.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Neuroglobin or NM_021257"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Neuroglobin
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207482 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCGCCCGGAGCCCGAGCTGATCCGGCAGAGCTGGCGGGCAGTGAGCCGCAGCCCGCTGGAGCACG
GCACCGTCCTGTTTGCCAGGCTGTTTGCCCTGGAGCCTGACCTGCTGCCCCTCTTCCAGTACAACTGCCG
CCAGTTCTCCAGCCCAGAGGACTGTCTCTCCTCGCCTGAGTTCCTGGACCACATCAGGAAGGTGATGCTC
GTGATTGATGCTGCAGTGACCAATGTGGAAGACCTGTCCTCACTGGAGGAGTACCTTGCCAGCCTGGGCA
GGAAGCACCGGGCAGTGGGTGTGAAGCTCAGCTCCTTCTCGACAGTGGGTGAGTCTCTGCTCTACATGCT
GGAGAAGTGTCTGGGCCCTGCCTTCACACCAGCCACACGGGCTGCCTGGAGCCAACTCTACGGGGCCGTA
GTGCAGGCCATGAGTCGAGGCTGGGATGGCGAG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC207482 protein sequence
Red=Cloning site Green=Tags(s)

MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVML
VIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAV
VQAMSRGWDGE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_021257
ORF Size 453 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_021257.3, NP_067080.1
RefSeq Size 1885 bp
RefSeq ORF 456 bp
Locus ID 58157
UniProt ID Q9NPG2, A0M8W9, F6ZE01, A0A1L1SVG2
Cytogenetics 14q24.3
MW 16.9 kDa
Summary This gene encodes an oxygen-binding protein that is distantly related to members of the globin gene family. It is highly conserved among other vertebrates. It is expressed in the central and peripheral nervous system where it may be involved in increasing oxygen availability and providing protection under hypoxic/ischemic conditions. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_021257" in other vectors (6)
SKU Description Size Price
RC207482L1 Lenti ORF clone of Human neuroglobin (NGB), Myc-DDK-tagged 10 ug
$450.00
RC207482L2 Lenti ORF clone of Human neuroglobin (NGB), mGFP tagged 10 ug
$450.00
RC207482L3 Lenti ORF clone of Human neuroglobin (NGB), Myc-DDK-tagged 10 ug
$450.00
RC207482L4 Lenti ORF clone of Human neuroglobin (NGB), mGFP tagged 10 ug
$450.00
RG207482 NGB (tGFP-tagged) - Human neuroglobin (NGB) 10 ug
$489.00
SC122910 NGB (untagged)-Human neuroglobin (NGB) 10 ug
$150.00

Plasmid Map for RC207482

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC207482
Circular map for RC207482

file-alt Citations

Methods and Protocols for Using Extracellular Vesicles as Delivery Vehicles in Neuronal Research
Vaidya, Sayeed, Hobson et al
Methods Mol Biol (2023) 2668, 159-189 DOI: 10.1007/978-1-0716-3203-1_13
Cited by 2
Snippet: Neuroglobin (NGB) (NM_021257) human-tagged ORF clone, NGB (Myc-DDK-tagged)-human neuroglobin (NGB) as template DNA (OriGene catalog # RC207482). ORF length: 456 base pairs
Neuroglobin overexpression plays a pivotal role in neuroprotection through mitochondrial raft-like microdomains in neuroblastoma SK-N-BE2 cells
Garofalo, Ferri, Sorice et al
Mol. Cell. Neurosci. (2018) 88, 167-176 DOI: 10.1016/j.mcn.2018.01.007
AI Summary: OriGene’s NGB-pCMV6-XL5 plasmid was used to subclone and overexpress human neuroglobin (NGB) in SK-N-BE2 cells, enabling the study of NGB’s neuroprotective role in mitochondrial raft-like microdomains under oxidative stress.
Snippet: NM_021257.3) was subcloned using the forward primer 5'-AAAAAGATATCAT GGAGCGCCCGGAGCCCGAG-3′ and the reverse primer 5'-AAAACTCGAGCTCGCCATC CCAGCCTCGACT-3′, by conventional PCR techniques from NGB-pCMV6-XL5 (Origene
Hemin protects against oxygen-glucose deprivation-induced apoptosis activation via neuroglobin in SH-SY5Y cells
Wang, Peng, Deng et al
Neurochem. Res. (2017)
AI Summary: OriGene's human neuroglobin (Ngb) cDNA clone was used to generate an expression vector for studying the role of Ngb in the neuroprotective effects of hemin in SH-SY5Y cells exposed to oxygen-glucose deprivation.
Snippet: experiments. In addition, the vector expressing human Ngb was generated using human cDNA clone from Origene (MD, USA) and subcloned into the KpnI and XbaI sites of pcDNA3.1;the construct was verified by direct sequencing. ... Cite SaveSaving
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products