OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CDRL2 (CDR2L) (NM_014603) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC206909
CDR2L (Myc-DDK-tagged)-Human cerebellar degeneration-related protein 2-like (CDR2L)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA343744 Rabbit Polyclonal Anti-CDR2L Antibody
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "CDRL2 or NM_014603"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CDRL2
Synonyms HUMPPA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC206909 representing NM_014603
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGGAGAGCCGCCGGGATGGAGGACTTCTCCGCGGAGGAAGAGGAGTCCTGGTACGACCAGCAGGACC
TGGAGCAGGACTTGCACCTAGCTGCGGAGCTGGGGAAGACTCTGCTGGAGAGGAACAAGGAGCTGGAGGG
GTCCCTGCAGCAGATGTACTCCACCAATGAGGAACAGGTGCAGGAGATCGAGTACCTAACCAAGCAGCTG
GACACGCTGCGGCACGTGAACGAGCAGCACGCCAAAGTCTATGAGCAGCTGGACCTGACAGCCCGGGACC
TGGAGCTGACCAACCACAGGCTGGTGCTGGAGAGTAAGGCTGCCCAGCAGAAGATCCATGGGCTGACGGA
GACCATTGAGCGCCTCCAGGCTCAGGTGGAGGAGCTGCAGGCCCAGGTGGAGCAACTGAGAGGCCTGGAA
CAGCTGCGAGTGCTCCGGGAGAAGCGGGAACGCAGGCGTACCATCCACACCTTCCCCTGCCTCAAGGAGC
TGTGCACCAGCCCCCGGTGCAAGGATGCTTTCCGCCTACACAGTTCCTCCCTGGAGCTGGGCCCGCGGCC
CCTGGAGCAGGAGAACGAGCGGCTGCAGACCCTGGTGGGGGCGCTGCGCTCCCAGGTGAGCCAGGAGCGG
CAGCGCAAGGAGCGGGCGGAGCGCGAGTACACCGCGGTGCTGCAGGAGTACTCGGAGCTGGAGCGCCAGC
TGTGCGAGATGGAGGCCTGTCGCCTGCGTGTGCAGGAGCTGGAGGCCGAGCTGCTGGAGCTGCAGCAGAT
GAAGCAGGCCAAGACCTACCTACTGGGTCCGGACGACCACCTGGCCGAGGCCCTGCTCGCACCCCTCACG
CAGGCCCCTGAGGCCGACGATCCCCAGCCCGGCCGCGGGGACGACTTGGGCGCCCAGGACGGGGTCTCCT
CACCGGCAGCCTCTCCAGGCCACGTGGTGCGCAAGAGCTGCAGCGACACTGCGCTCAACGCCATCGTGGC
CAAAGACCCAGCCAGCCGGCACGCGGGCAACCTCACACTGCACGCCAACAGCGTGCGCAAGCGGGGCATG
TCCATCCTGCGGGAGGTGGACGAGCAGTACCACGCGCTGCTGGAGAAGTACGAGGAGCTGCTGAGCAAGT
GCCGGCAGCACGGGGCCGGAGTGCGGCACGCCGGCGTGCAGACCTCGCGCCCCATCTCCCGGGACAGCTC
GTGGAGGGACCTGCGCGGGGGTGAGGAGGGCCAGGGTGAGGTCAAGGCAGGAGAGAAGAGCCTGAGCCAG
CACGTGGAGGCCGTGGACAAGCGGCTGGAACAGAGCCAGCCCGAGTACAAGGCGCTCTTCAAAGAGATCT
TCTCCAGGATCCAGAAGACCAAGGCTGACATCAACGCCACCAAAGTCAAGACGCACAGCAGCAAG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC206909 representing NM_014603
Red=Cloning site Green=Tags(s)

MRRAAGMEDFSAEEEESWYDQQDLEQDLHLAAELGKTLLERNKELEGSLQQMYSTNEEQVQEIEYLTKQL
DTLRHVNEQHAKVYEQLDLTARDLELTNHRLVLESKAAQQKIHGLTETIERLQAQVEELQAQVEQLRGLE
QLRVLREKRERRRTIHTFPCLKELCTSPRCKDAFRLHSSSLELGPRPLEQENERLQTLVGALRSQVSQER
QRKERAEREYTAVLQEYSELERQLCEMEACRLRVQELEAELLELQQMKQAKTYLLGPDDHLAEALLAPLT
QAPEADDPQPGRGDDLGAQDGVSSPAASPGHVVRKSCSDTALNAIVAKDPASRHAGNLTLHANSVRKRGM
SILREVDEQYHALLEKYEELLSKCRQHGAGVRHAGVQTSRPISRDSSWRDLRGGEEGQGEVKAGEKSLSQ
HVEAVDKRLEQSQPEYKALFKEIFSRIQKTKADINATKVKTHSSK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_014603
ORF Size 1395 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014603.3
RefSeq Size 3546 bp
RefSeq ORF 1398 bp
Locus ID 30850
UniProt ID Q86X02
Cytogenetics 17q25.1
MW 52.8 kDa
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_014603" in other vectors (5)
SKU Description Size Price
RC206909L3 Lenti-ORF clone of CDR2L (Myc-DDK-tagged)-Human cerebellar degeneration-related protein 2-like (CDR2L) 10 ug
$757.00
RC206909L4 Lenti-ORF clone of CDR2L (mGFP-tagged)-Human cerebellar degeneration-related protein 2-like (CDR2L) 10 ug
$757.00
RG206909 CDR2L (tGFP-tagged) - Human cerebellar degeneration-related protein 2-like (CDR2L) 10 ug
$489.00 $657.00
SC126162 CDR2L (untagged)-Human cerebellar degeneration-related protein 2-like (CDR2L) 10 ug
$457.00
SC317763 CDR2L (untagged)-Human cerebellar degeneration-related protein 2-like (CDR2L) 10 ug
$503.00

Plasmid Map for RC206909

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC206909
Circular map for RC206909

file-alt Citations

A cerebellar degeneration-related protein 2-like cell-based assay for anti-Yo detection in patients with paraneoplastic cerebellar degeneration
Erikstad, Herdlevaer, Peter et al
Eur J Neurol (2023)
Cited by 5
AI Summary: OriGene’s Myc-DDK-tagged CDR2L plasmid (OriGene, #RC206909) was used to transfect cells for the development of the cell-based assay that enabled specific detection of anti-CDR2L antibodies in patients with paraneoplastic cerebellar degeneration.
Snippet: Cells were then transfected using Lipofectamine 3000 Reagent (Invitrogen, #L3000008) with plasmid for expression of Myc-DDK-tagged CDR2L (Origene, #RC206909)
Paraneoplastic Cerebellar Degeneration: The Importance of Including CDR2L as a Diagnostic Marker
Herdlevær, Haugen, Mazengia et al
Neurol Neuroimmunol Neuroinflamm (2021) 8 (2) DOI: 10.1212/NXI.0000000000000963
AI Summary: OriGene products contributed to this study by providing recombinant CDR2 (Cat# TP319941) and CDR2L (Cat# TP323307) proteins, which were used in the in-house Western blot assays to assess patient antibody reactivity and improve the specificity of paraneoplastic cerebellar degeneration diagnosis.
FigureFigureFigure
Paraneoplastic cerebellar degeneration: Characterizing the Yo antibody antigens
Kråkenes
Thesis (2021)
Snippet: Full-length CDR2 (OriGene Technologies, Rockville, MD, #RG204900) and CDR2L (OriGene Technologies, #RC206909) were ligated into a pCMV6-AC-GFP vector (OriGene Technologies, #PS100010)
CDR2L Is the Major Yo Antibody Target in Paraneoplastic Cerebellar Degeneration
Kråkenes, Herdlevaer, Raspotnig et al
Ann. Neurol. (2019)
AI Summary: OriGene products—full-length CDR2 (#RG204900), CDR2L (#RC206909), and the pCMV6-AC-GFP vector (#PS100010)—were used to generate recombinant proteins for transfection experiments, enabling the study to determine that CDR2L is the primary Yo antibody target in paraneoplastic cerebellar degeneration.
Snippet: All rights reserved. Page 7. Full-length CDR2 (Origene, #RG204900) and CDR2L (Origene, #RC206909) were ligated into a pCMV6-AC-GFP vector (OriGene, #PS100010). Following PCR, correct CDR2 and CDR2L vector sequences were confirmed using BioEdit
Paraneoplastic syndrome-associated neuronal antibodies in adult ADHD
Haukanes, Hegvik, Eichler et al
J Neuroimmunol (2015) 288, 87-91 DOI: 10.1016/j.jneuroim.2015.08.018
Cited by 4
AI Summary: OriGene products contributed to this study by providing the anti-Yo antibody (catalog #AM09316PU-N), which was used to investigate the presence of paraneoplastic syndrome-associated neuronal antibodies in adult ADHD patient sera.
CDR2L Antibodies: A New Player in Paraneoplastic Cerebellar Degeneration
Eichler, Totland, Haugen et al
PLoS ONE (2013) 8 (6), e66002 DOI: 10.1371/journal.pone.0066002
Cited by 57
AI Summary: OriGene’s anti-myc antibody (TA50014) was used for immunostaining experiments in this study to help detect tagged proteins, contributing to the characterization of CDR2 and CDR2L antibodies in paraneoplastic cerebellar degeneration.
Snippet: Anti myc (Origene, TA50014) was used 1:300, anti CDR2L (Biosite, ARP39113_P050) was used 1:600. ... 5). The CDR2L antibodies gave a strong band of approximately 62 kDa in a Western blot of human cerebellum extract.
WB IF
Showing 1-6 of 7 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products