DUSP6 (NM_001946) Human Tagged ORF Clone

SKU
RC206765
DUSP6 (Myc-DDK-tagged)-Human dual specificity phosphatase 6 (DUSP6), transcript variant 1
  $686.00
In Stock*
Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DUSP6
Synonyms HH19; MKP3; PYST1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC206765 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATAGATACGCTCAGACCCGTGCCCTTCGCGTCGGAAATGGCGATCAGCAAGACGGTGGCGTGGCTCA
ACGAGCAGCTGGAGCTGGGCAACGAGCGGCTGCTGCTGATGGACTGCCGGCCGCAGGAGCTATACGAGTC
GTCGCACATCGAGTCGGCCATCAACGTGGCCATCCCGGGCATCATGCTGCGGCGCCTGCAGAAGGGTAAC
CTGCCGGTGCGCGCGCTCTTCACGCGCGGCGAGGACCGGGACCGCTTCACCCGGCGCTGTGGCACCGACA
CAGTGGTGCTCTACGACGAGAGCAGCAGCGACTGGAACGAGAATACGGGCGGCGAGTCGGTGCTCGGGCT
GCTGCTCAAGAAGCTCAAGGACGAGGGCTGCCGGGCGTTCTACCTGGAAGGTGGCTTCAGTAAGTTCCAA
GCCGAGTTCTCCCTGCATTGCGAGACCAATCTAGACGGCTCGTGTAGCAGCAGCTCGCCGCCGTTGCCAG
TGCTGGGGCTCGGGGGCCTGCGGATCAGCTCTGACTCTTCCTCGGACATCGAGTCTGACCTTGACCGAGA
CCCCAATAGTGCAACAGACTCGGATGGTAGTCCGCTGTCCAACAGCCAGCCTTCCTTCCCAGTGGAGATC
TTGCCCTTCCTCTACTTGGGCTGTGCCAAAGACTCCACCAACTTGGACGTGTTGGAGGAATTCGGCATCA
AGTACATCTTGAACGTCACCCCCAATTTGCCGAATCTCTTTGAGAACGCAGGAGAGTTTAAATACAAGCA
AATCCCCATCTCGGATCACTGGAGCCAAAACCTGTCCCAGTTTTTCCCTGAGGCCATTTCTTTCATAGAT
GAAGCCCGGGGCAAGAACTGTGGTGTCTTGGTACATTGCTTGGCTGGCATTAGCCGCTCAGTCACTGTGA
CTGTGGCTTACCTTATGCAGAAGCTCAATCTGTCGATGAACGATGCCTATGACATTGTCAAAATGAAAAA
ATCCAACATATCCCCTAACTTCAACTTCATGGGTCAGCTGCTGGACTTCGAGAGGACGCTGGGACTCAGC
AGCCCATGTGACAACAGGGTTCCAGCACAGCAGCTGTATTTTACCACCCCTTCCAACCAGAATGTATACC
AGGTGGACTCTCTGCAATCTACG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC206765 protein sequence
Red=Cloning site Green=Tags(s)

MIDTLRPVPFASEMAISKTVAWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPGIMLRRLQKGN
LPVRALFTRGEDRDRFTRRCGTDTVVLYDESSSDWNENTGGESVLGLLLKKLKDEGCRAFYLEGGFSKFQ
AEFSLHCETNLDGSCSSSSPPLPVLGLGGLRISSDSSSDIESDLDRDPNSATDSDGSPLSNSQPSFPVEI
LPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFID
EARGKNCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLS
SPCDNRVPAQQLYFTTPSNQNVYQVDSLQST

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001946
ORF Size 1143 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001946.4
RefSeq Size 3395 bp
RefSeq ORF 1146 bp
Locus ID 1848
UniProt ID Q16828
Cytogenetics 12q21.33
Domains DSPc, RHOD
Protein Families Druggable Genome, Phosphatase
Protein Pathways MAPK signaling pathway
MW 42.3 kDa
Summary The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates ERK2, is expressed in a variety of tissues with the highest levels in heart and pancreas, and unlike most other members of this family, is localized in the cytoplasm. Mutations in this gene have been associated with congenital hypogonadotropic hypogonadism. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2014]
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_001946" in other vectors (6)
SKU Description Size Price
RC206765L1 Lenti ORF clone of Human dual specificity phosphatase 6 (DUSP6), transcript variant 1, Myc-DDK-tagged 10 ug
$986.00
RC206765L2 Lenti ORF clone of Human dual specificity phosphatase 6 (DUSP6), transcript variant 1, mGFP tagged 10 ug
$986.00
RC206765L3 Lenti ORF clone of Human dual specificity phosphatase 6 (DUSP6), transcript variant 1, Myc-DDK-tagged 10 ug
$986.00
RC206765L4 Lenti ORF clone of Human dual specificity phosphatase 6 (DUSP6), transcript variant 1, mGFP tagged 10 ug
$986.00
RG206765 DUSP6 (tGFP-tagged) - Human dual specificity phosphatase 6 (DUSP6), transcript variant 1 10 ug
$886.00
SC321781 DUSP6 (untagged)-Human dual specificity phosphatase 6 (DUSP6), transcript variant 1 10 ug
$686.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.