OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ZNF597 (NM_152457) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC206744
ZNF597 (Myc-DDK-tagged)-Human zinc finger protein 597 (ZNF597)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA345546 Rabbit Polyclonal Anti-ZNF597 Antibody
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "ZNF597 or NM_152457"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ZNF597
Synonyms HIT-4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC206744 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTCCATGCCCCCGACGCCCGAGGCCCAGGGACCAATACTGTTTGAGGATCTGGCTGTGTATTTTT
CTCAAGAGGAGTGCGTGACTCTGCACCCTGCCCAGAGGTCCCTCAGCAAAGATGGTACAAAAGAGTCTTT
GGAGGATGCGGCTTTGATGGGAGAGGAAGGCAAGCCTGAGATTAATCAGCAGTTAAGCCTAGAGTCTATG
GAACTTGACGAGCTTGCCTTAGAAAAGTACCCCATTGCTGCACCCCTTGTCCCTTACCCAGAAAAATCCT
CTGAGGATGGAGTTGGAAACCCTGAAGCGAAAATATTAAGTGGAACTCCCACTTACAAGAGAAGGGTCAT
CAGCCTTTTAGTTACCATTGAAAACCACACCCCATTAGTAGAACTCTCTGAATATTTAGGAACCAACACA
CTTTCTGAAATTCTTGATTCTCCCTGGGAAGGAGCCAAAAATGTGTACAAATGTCCTGAGTGTGACCAAA
ACTTCAGCGATCATTCATACCTAGTTTTGCATCAGAAAATTCATTCAGGAGAGAAAAAACATAAATGTGG
TGACTGTGGAAAGATCTTCAATCATAGAGCCAACCTGAGGACACACAGGAGAATCCATACTGGTGAGAAA
CCTTATAAGTGTGCCAAGTGCAGTGCCAGCTTTCGCCAGCACTCTCATCTATCCCGACACATGAATAGCC
ACGTAAAGGAGAAGCCCTATACATGTAGCATATGTGGTAGAGGTTTTATGTGGCTCCCAGGATTGGCACA
GCATCAGAAAAGCCACAGTGCTGAAAACACCTACGAATCTACTAACTGTGATAAACATTTTAATGAGAAA
CCAAATCTTGCTTTGCCTGAGGAAACATTCGTATCAGGCCCCCAGTACCAGCACACTAAGTGCATGAAGA
GCTTCAGGCAGTCCTTATATCCTGCCCTTTCCGAGAAGAGCCACGACGAGGACTCTGAACGCTGCAGCGA
TGATGGGGACAATTTCTTCTCATTCTCAAAATTCAAGCCCTTACAGTGTCCTGACTGTGACATGACCTTT
CCTTGTTTCTCTGAGCTTATTTCCCATCAGAACATTCATACAGAGGAAAGGCCCCATAAGTGCAAAACAT
GCGAGGAAAGTTTTGCTTTGGACTCAGAACTTGCATGCCACCAGAAGAGCCACATGCTAGCGGAACCTTT
TAAATGTACCGTGTGTGGGAAAACTTTCAAGTCGAATTTGCATCTCATTACTCATAAGCGAACTCACATA
AAAAACACCACG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC206744 protein sequence
Red=Cloning site Green=Tags(s)

MASMPPTPEAQGPILFEDLAVYFSQEECVTLHPAQRSLSKDGTKESLEDAALMGEEGKPEINQQLSLESM
ELDELALEKYPIAAPLVPYPEKSSEDGVGNPEAKILSGTPTYKRRVISLLVTIENHTPLVELSEYLGTNT
LSEILDSPWEGAKNVYKCPECDQNFSDHSYLVLHQKIHSGEKKHKCGDCGKIFNHRANLRTHRRIHTGEK
PYKCAKCSASFRQHSHLSRHMNSHVKEKPYTCSICGRGFMWLPGLAQHQKSHSAENTYESTNCDKHFNEK
PNLALPEETFVSGPQYQHTKCMKSFRQSLYPALSEKSHDEDSERCSDDGDNFFSFSKFKPLQCPDCDMTF
PCFSELISHQNIHTEERPHKCKTCEESFALDSELACHQKSHMLAEPFKCTVCGKTFKSNLHLITHKRTHI
KNTT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_152457
ORF Size 1272 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_152457.1, NP_689670.1
RefSeq Size 1838 bp
RefSeq ORF 1275 bp
Locus ID 146434
UniProt ID Q96LX8
Cytogenetics 16p13.3
Domains KRAB, zf-C2H2
Protein Families Transcription Factors
MW 48.1 kDa
Summary This gene encodes a protein with multiple zinc finger domains. Loss of the related gene in rodents results in defects in neural development and embryonic lethality in mutant homozygotes. This gene is adjacent to a differentially methylated region (DMR) and is imprinted and maternally expressed. provided by RefSeq, Nov 2015
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_152457" in other vectors (5)
SKU Description Size Price
RC206744L3 Lenti ORF clone of Human zinc finger protein 597 (ZNF597), Myc-DDK-tagged 10 ug
$757.00
RC206744L4 Lenti ORF clone of Human zinc finger protein 597 (ZNF597), mGFP tagged 10 ug
$757.00
RG206744 ZNF597 (tGFP-tagged) - Human zinc finger protein 597 (ZNF597) 10 ug
$489.00 $657.00
SC101019 ZNF597 (untagged)-Human zinc finger protein 597 (ZNF597) 10 ug
$457.00
SC324289 ZNF597 (untagged)-Human zinc finger protein 597 (ZNF597) 10 ug
$457.00

Plasmid Map for RC206744

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC206744
Circular map for RC206744

file-alt Citations

Somatic uniparental disomy of Chromosome 16p in hemimegalencephaly
Griffin, Cronin, Walley et al
Cold Spring Harb Mol Case Stud (2017) 3 (5) DOI: 10.1101/mcs.a001735
AI Summary: In this study, OriGene products ZNF597 cDNA (#RC206744) and ZDHHC17 (HIP14) cDNA (#RC207982L1) were used to investigate protein expression and interactions, aiding in the functional analysis of candidate genes implicated in hemimegalencephaly.
Snippet: … ZNF597 Protein-Protein Interactions ZNF597 cDNA was obtained from OriGene (#RC206744), and cloned into pLD-puro-CcVA vector for high expression View as HTML;ZNF597 cDNA was obtained from OriGene (#RC206744) and cloned into pLD-puro-CcVA vector for high expression. The VA tag attached to the carboxyl terminus of ZNF597 consists of three Flag epitopes, a double tobacco etch virus (TEV) protease cleavage site, six His, and a StrepIII tag in series, ∼12 kDa in mass. ZDHHC17 (HIP14) cDNA was obtained from OriGene (#RC207982L1) containing both Myc and Flag tags at the carboxyl terminus
FigureFigureFigure
Uniparental disomy of Chromosome 16p in hemimegalencephaly
Griffin, Cronin, Walley et al
Molecular Case Studies (2017)
Snippet: Light-microscopy images were acquired using a Leica DM4000 B microscope. ZNF597 Protein-Protein Interactions ZNF597 cDNA was obtained from OriGene (#RC206744), and cloned into pLD-puro-CcVA vector for high expression. ... Cite SaveSaving
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products