OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RILP (NM_031430) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC206400
RILP (Myc-DDK-tagged)-Human Rab interacting lysosomal protein (RILP)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA320035 Rabbit Polyclonal RILP Antibody
100 ug
$640.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "RILP or NM_031430"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RILP
Synonyms PP10141
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC206400 representing NM_031430
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCCCAGGAGGGCGGCGCCCGGGGTGCCTGGCTGGGGGTCTCGGGAGGCCGCGGGGTCGGCATCGG
CCGCGGAGCTTGTGTACCATCTAGCCGGGGCCCTGGGCACTGAGCTGCAGGATCTGGCGCGCCGTTTCGG
GCCGGAGGCGGCGGCCGGGCTGGTGCCGCTAGTGGTGCGGGCGCTGGAGCTCTTGGAACAGGCTGCCGTG
GGGCCCGCCCCGGACTCGCTGCAGGTGTCGGCGCAGCCGGCGGAGCAGGAGCTGCGGCGGCTGCGGGAGG
AGAACGAGCGCCTCCGCAGGGAGCTGCGCGCGGGGCCACAGGAGGAGCGCGCGCTGCTGCGGCAGCTCAA
GGAGGTCACGGACCGACAGCGGGACGAACTCCGGGCGCACAACCGCGACCTGCGGCAGCGCGGCCAGGAG
ACCGAGGCGTTGCAGGAGCAGCTGCAGCGCCTCCTGCTGGTGAACGCTGAGCTGCGGCACAAGCTGGCGG
CCATGCAGACCCAGCTGCGCGCCGCGCAGGACCGCGAGAGGGAGCGCCAGCAGCCTGGCGAAGCCGCGAC
TCCGCAGGCTAAAGAGCGAGCGCGGGGGCAGGCCGGGCGGCCCGGGCACCAGCACGGACAGGAGCCCGAA
TGGGCGACCGCCGGCGCAGGCGCCCCAGGGAACCCTGAGGACCCGGCGGAGGCCGCGCAGCAGCTCGGGC
GCCCCTCGGAGGCAGGGCAGTGCCGCTTCAGTCGGGAGGAGTTTGAGCAGATCCTTCAGGAGCGGAATGA
ACTCAAAGCCAAAGTGTTCCTGCTCAAGGAGGAACTGGCCTACTTCCAGCGGGAGCTGCTCACAGACCAC
CGGGTCCCCGGCCTTCTGCTCGAGGCCATGAAGGTGGCTGTCCGGAAGCAGCGGAAGAAGATCAAGGCCA
AGATGTTAGGGACACCAGAGGAAGCAGAGAGCAGTGAGGATGAGGCTGGCCCATGGATCCTGCTCTCCGA
TGACAAGGGAGACCATCCCCCACCCCCGGAGTCCAAAATACAGAGTTTCTTTGGCCTATGGTATCGGGGT
AAAGCTGAATCCTCTGAGGATGAGACCAGCAGCCCTGCACCCAGCAAGCTAGGGGGAGAAGAGGAGGCCC
AACCACAGTCTCCAGCTCCTGATCCGCCCTGTTCTGCCCTCCACGAACACCTTTGTCTGGGGGCCTCAGC
CGCCCCAGAGGCC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC206400 representing NM_031430
Red=Cloning site Green=Tags(s)

MEPRRAAPGVPGWGSREAAGSASAAELVYHLAGALGTELQDLARRFGPEAAAGLVPLVVRALELLEQAAV
GPAPDSLQVSAQPAEQELRRLREENERLRRELRAGPQEERALLRQLKEVTDRQRDELRAHNRDLRQRGQE
TEALQEQLQRLLLVNAELRHKLAAMQTQLRAAQDRERERQQPGEAATPQAKERARGQAGRPGHQHGQEPE
WATAGAGAPGNPEDPAEAAQQLGRPSEAGQCRFSREEFEQILQERNELKAKVFLLKEELAYFQRELLTDH
RVPGLLLEAMKVAVRKQRKKIKAKMLGTPEEAESSEDEAGPWILLSDDKGDHPPPPESKIQSFFGLWYRG
KAESSEDETSSPAPSKLGGEEEAQPQSPAPDPPCSALHEHLCLGASAAPEA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_031430
ORF Size 1203 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_031430.3
RefSeq Size 1811 bp
RefSeq ORF 1206 bp
Locus ID 83547
UniProt ID Q96NA2
Cytogenetics 17p13.3
MW 44 kDa
Summary This gene encodes a lysosomal protein that interacts with RAB7, a small GTPase that controls transport to endocytic degradative compartments. Studies using mutant forms of the two proteins suggest that this protein represents a downstream effector for RAB7, and both proteins act together in the regulation of late endocytic traffic. A unique region of this protein has also been shown to be involved in the regulation of lysosomal morphology. provided by RefSeq, Sep 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_031430" in other vectors (6)
SKU Description Size Price
RC206400L1 Lenti ORF clone of Human Rab interacting lysosomal protein (RILP), Myc-DDK-tagged 10 ug
$757.00
RC206400L2 Lenti ORF clone of Human Rab interacting lysosomal protein (RILP), mGFP tagged 10 ug
$757.00
RC206400L3 Lenti ORF clone of Human Rab interacting lysosomal protein (RILP), Myc-DDK-tagged 10 ug
$757.00
RC206400L4 Lenti ORF clone of Human Rab interacting lysosomal protein (RILP), mGFP tagged 10 ug
$757.00
RG206400 RILP (tGFP-tagged) - Human Rab interacting lysosomal protein (RILP) 10 ug
$657.00
SC123848 RILP (untagged)-Human Rab interacting lysosomal protein (RILP) 10 ug
$457.00

Plasmid Map for RC206400

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC206400
Circular map for RC206400

file-alt Citations

The Arg/N-degron pathway mediates the secretion of apoptotic exosomes under oxidative stress in cancer cell
Kim, Lee, Jung et al
iScience (2025) 28 (6), 112637 DOI: 10.1016/j.isci.2025.112637
Cited by 1
AI Summary: In this study, OriGene products RILP-MYC,FLAG (Cat#RC206400), VPS22-MYC,FLAG (Cat#RC202137), VPS36-GFP (Cat#RG237476), and ANXA1-MYC,FLAG (Cat#RC201569) were used as tagged protein constructs to investigate the molecular mechanisms underlying apoptotic exosome secretion in cancer cells under oxidative stress.
Snippet: RILP-MYC,FLAG Origene Cat#RC206400 Cleaved-RILP-MYC,FLAG This paper VPS22-MYC,FLAG Origene Cat#RC202137 VPS36-GFP Origene Cat#RG237476 Caspase1-MYC Addgene Cat#41552 ARL8B-V5 Addgene Cat#67446 KLC-MCHERRY Addgene Cat#62747 ANXA1-MYC,FLAG Origene Cat#RC201569
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products