OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Apolipoprotein H (APOH) (NM_000042) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC205017
APOH (Myc-DDK-tagged)-Human apolipoprotein H (beta-2-glycoprotein I) (APOH)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA807147 APOH mouse monoclonal antibody, clone OTI4A11 (formerly 4A11) 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Apolipoprotein H or NM_000042"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Apolipoprotein H
Synonyms B2G1; B2GP1; BG
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205017 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATTTCTCCAGTGCTCATCTTGTTCTCGAGTTTTCTCTGCCATGTTGCTATTGCAGGACGGACCTGTC
CCAAGCCAGATGATTTACCATTTTCCACAGTGGTCCCGTTAAAAACATTCTATGAGCCAGGAGAAGAGAT
TACGTATTCCTGCAAGCCGGGCTATGTGTCCCGAGGAGGGATGAGAAAGTTTATCTGCCCTCTCACAGGA
CTGTGGCCCATCAACACTCTGAAATGTACACCCAGAGTATGTCCTTTTGCTGGAATCTTAGAAAATGGAG
CCGTACGCTATACGACTTTTGAATATCCCAACACGATCAGTTTTTCTTGTAACACTGGGTTTTATCTGAA
TGGCGCTGATTCTGCCAAGTGCACTGAGGAAGGAAAATGGAGCCCGGAGCTTCCTGTCTGTGCTCCCATC
ATCTGCCCTCCACCATCCATACCTACGTTTGCAACACTTCGTGTTTATAAGCCATCAGCTGGAAACAATT
CCCTCTATCGGGACACAGCAGTTTTTGAATGTTTGCCACAACATGCGATGTTTGGAAATGATACAATTAC
CTGCACGACACATGGAAATTGGACTAAATTACCAGAATGCAGGGAAGTAAAATGCCCATTCCCATCAAGA
CCAGACAATGGATTTGTGAACTATCCTGCAAAACCAACACTTTATTACAAGGATAAAGCCACATTTGGCT
GCCATGATGGATATTCTCTGGATGGCCCGGAAGAAATAGAATGTACCAAACTGGGAAACTGGTCTGCCAT
GCCAAGTTGTAAAGCATCTTGTAAAGTACCTGTGAAAAAAGCCACTGTGGTGTACCAAGGAGAGAGAGTA
AAGATTCAGGAAAAATTTAAGAATGGAATGCTACATGGTGATAAAGTTTCTTTCTTCTGCAAAAATAAGG
AAAAGAAGTGTAGCTATACAGAGGATGCTCAGTGTATAGATGGCACTATCGAAGTCCCCAAATGCTTCAA
GGAACACAGTTCTCTGGCTTTTTGGAAAACTGATGCATCCGATGTAAAGCCATGC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC205017 protein sequence
Red=Cloning site Green=Tags(s)

MISPVLILFSSFLCHVAIAGRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTG
LWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPI
ICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSR
PDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERV
KIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_000042
ORF Size 1035 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000042.3
RefSeq Size 1216 bp
RefSeq ORF 1038 bp
Locus ID 350
UniProt ID P02749, A0A384NKM6
Cytogenetics 17q24.2
Domains CCP
Protein Families Druggable Genome, Secreted Protein
MW 38.3 kDa
Summary Apolipoprotein H, also known as beta-2-glycoprotein I, is a component of circulating plasma lipoproteins. It has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, hemostasis, and the production of antiphospholipid autoantibodies. APOH may be a required cofactor for anionic phospholipid binding by the antiphospholipid autoantibodies found in sera of many patients with lupus and primary antiphospholipid syndrome (APS). The anti-beta (2) glycoprotein I antibodies from APS patients, mediate inhibition of activated protein C which has anticoagulant properties. Because beta-2-GPI is the main autoantigen in patients with APS, the disruption of this pathway by autoantibodies may be an important mechanism for thrombosis in patients with APS.provided by RefSeq, Dec 2019
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_000042" in other vectors (6)
SKU Description Size Price
RC205017L1 Lenti ORF clone of Human apolipoprotein H (beta-2-glycoprotein I) (APOH), Myc-DDK-tagged 10 ug
$757.00
RC205017L2 Lenti ORF clone of Human apolipoprotein H (beta-2-glycoprotein I) (APOH), mGFP tagged 10 ug
$757.00
RC205017L3 Lenti ORF clone of Human apolipoprotein H (beta-2-glycoprotein I) (APOH), Myc-DDK-tagged 10 ug
$757.00
RC205017L4 Lenti ORF clone of Human apolipoprotein H (beta-2-glycoprotein I) (APOH), mGFP tagged 10 ug
$757.00
RG205017 APOH (tGFP-tagged) - Human apolipoprotein H (beta-2-glycoprotein I) (APOH) 10 ug
$489.00 $657.00
SC113997 APOH (untagged)-Human apolipoprotein H (beta-2-glycoprotein I) (APOH) 10 ug
$457.00

Plasmid Map for RC205017

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC205017
Circular map for RC205017

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products