OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PC4 (SUB1) (NM_006713) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC204999
SUB1 (Myc-DDK-tagged)-Human SUB1 homolog (S. cerevisiae) (SUB1)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $150.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA809399 SUB1 mouse monoclonal antibody,clone OTI4C10 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "PC4 or NM_006713"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PC4
Synonyms p14; P15; PC4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204999 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTAAATCAAAGGAACTTGTTTCTTCAAGCTCTTCTGGCAGTGATTCTGACAGTGAGGTTGACAAAA
AGTTAAAGAGGAAAAAGCAAGTTGCTCCAGAAAAACCTGTAAAGAAACAAAAGACAGGTGAGACTTCGAG
AGCCCTGTCATCTTCTAAACAGAGCAGCAGCAGCAGAGATGATAACATGTTTCAGATTGGGAAAATGAGG
TACGTTAGTGTTCGCGATTTTAAAGGCAAAGTGCTAATTGATATTAGAGAATATTGGATGGATCCTGAAG
GTGAAATGAAACCAGGAAGAAAAGGTATTTCTTTAAATCCAGAACAATGGAGCCAGCTGAAGGAACAGAT
TTCTGACATTGATGATGCAGTAAGAAAACTG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC204999 protein sequence
Red=Cloning site Green=Tags(s)

MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMR
YVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_006713
ORF Size 381 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006713.4
RefSeq Size 3522 bp
RefSeq ORF 384 bp
Locus ID 10923
UniProt ID P53999, Q6IBA2
Cytogenetics 5p13.3
Domains PC4
Protein Families Transcription Factors
MW 14.4 kDa
Summary General coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery. May be involved in stabilizing the multiprotein transcription complex. Binds single-stranded DNA. Also binds, in vitro, non-specifically to double-stranded DNA (ds DNA).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_006713" in other vectors (6)
SKU Description Size Price
RC204999L1 Lenti ORF clone of Human SUB1 homolog (S. cerevisiae) (SUB1), Myc-DDK-tagged 10 ug
$450.00
RC204999L2 Lenti ORF clone of Human SUB1 homolog (S. cerevisiae) (SUB1), mGFP tagged 10 ug
$450.00
RC204999L3 Lenti ORF clone of Human SUB1 homolog (S. cerevisiae) (SUB1), Myc-DDK-tagged 10 ug
$450.00
RC204999L4 Lenti ORF clone of Human SUB1 homolog (S. cerevisiae) (SUB1), mGFP tagged 10 ug
$450.00
RG204999 SUB1 (tGFP-tagged) - Human SUB1 homolog (S. cerevisiae) (SUB1) 10 ug
$489.00
SC115927 SUB1 (untagged)-Human SUB1 homolog (S. cerevisiae) (SUB1) 10 ug
$150.00

Plasmid Map for RC204999

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC204999
Circular map for RC204999

file-alt Citations

Characterization of cooperative PS-oligo activation of human TLR9
Pollak, Zhao, Crooke
Mol Ther Nucleic Acids (2023) 33, 832-844 DOI: 10.1016/j.omtn.2023.08.011
Cited by 9
AI Summary: OriGene products contributed to this study by providing plasmids encoding human TLR9 (catalog number RC207510) and PC4 (catalog number RC204999), which were used to generate fusion constructs for NanoBRET binding assays to investigate PS-oligo activation of TLR9.
Snippet: of 37°C, 5% CO2. NanoBRET binding assay N-terminal NLuc fusions were created using the vector pFN31K NLuc CMV-neo (Promega). Briefly, coding sequences of proteins were amplified from plasmids from Origene (TLR9, catalog number RC207510;PC4, catalog number RC204999) using PCR primers complementary to the full-length cDNAs. The PCR products were ligated to XhoI and EcoRI sites of the pFN31K NLuc
FigureFigureFigure
Interaction of ASOs with PC4 Is Highly Influenced by the Cellular Environment and ASO Chemistry
Vickers, Migawa, Seth et al
J. Am. Chem. Soc. (2020) 142 (21), 9661-9674 DOI: 10.1021/jacs.0c01808
Cited by 14
AI Summary: OriGene’s PC4 plasmid (RC204999) was used as a template to amplify the PC4 gene for constructing fusion proteins, enabling the study of ASO and PC4 interactions in this research.
Snippet: … Briefly, PC4 was amplified from plasmid RC204999 (Origene) using PCR primers complementary to the full-length cDNA (Table 2). …The LgBiT-PC4 fusion was created by replacing the existing NLuc with LgBiT in the fusion plasmid. …
Origins of the increased affinity of phosphorothioate-modified therapeutic nucleic acids for proteins
Hyjek-Składanowska, Vickers, Napiórkowska et al
J. Am. Chem. Soc. (2020) 142 (16), 7456-7468 DOI: 10.1021/jacs.9b13524
Cited by 101
AI Summary: OriGene contributed to this study by providing the PC4 cDNA plasmid (RC204999), which was used to amplify and express the PC4 protein for structural and binding analyses.
Snippet: … PC4 was amplified from plasmid RC204999 (Origene) using PCR primers complementary to the full length cDNA. …The N-terminal regulatory domain (amino acids 2-60) was subsequently deleted by site directed mutagenesis of the pNLuc-PC4
MicroRNA-101 regulated transcriptional modulator SUB1 plays a role in prostate cancer
Chakravarthi, Goswami, Pathi et al
Oncogene (2016)
Cited by 71
AI Summary: OriGene's SUB1 cDNA (cat. no. [not specified in snippet]) was used for in vitro overexpression experiments to study the role of SUB1 in prostate cancer cell function in this paper.
Snippet: A second identical transfection was performed 24 h later. Seventy-two hours after the first transfection, cells were harvested for RNA isolation or immunoblot analysis. In vitro overexpression. SUB1 cDNA (Origene Technologies, Rockville, MD, USA;cat. no. ... Related articles All 4 versions Cite SaveSaving
Showing 1-4 of 4 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products