OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PSG2 (NM_031246) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC204743
PSG2 (Myc-DDK-tagged)-Human pregnancy specific beta-1-glycoprotein 2 (PSG2)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA356203 PSG2 Antibody
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "PSG2 or NM_031246"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PSG2
Synonyms CEA; PSBG2; PSG1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204743 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGCCCCTCTCAGCCCCTCCCTGCACAGAGCACATCAAATGGAAGGGGCTCCTGCTCACAGCATCAC
TTTTAAACTTCTGGAACCTGCCCACCACTGCCCAAGTCACGATTGAAGCCCAGCCACCAAAAGTTTCCGA
GGGGAAGGATGTTCTTCTACTTGTCCACAATTTGCCCCAGAATCTTACTGGCTACATCTGGTACAAAGGG
CAAATCAGGGACCTCTACCATTACATTACATCATATGTAGTAGACGGTCAAATAATTATATATGGGCCTG
CATATAGTGGACGAGAAACAGCATATTCCAATGCATCCCTGCTGATCCAGAATGTCACCCGGGAGGACGC
AGGATCCTACACCTTACACATCATAAAGCGAGGTGATGGGACTAGAGGAGTAACTGGATATTTCACCTTC
ACCTTATACCTGGAGACTCCCAAGCCCTCCATCTCCAGCAGCAACTTAAACCCCAGGGAGGCCATGGAAA
CTGTGATCTTAACCTGTGATCCTGAGACTCCGGACACAAGCTACCAGTGGTGGATGAATGGTCAGAGCCT
CCCTATGACTCACAGGTTTCAGCTGTCCGAAACCAACAGGACCCTCTTTCTATTTGGTGTCACAAAGTAT
ACTGCAGGACCCTATGAATGTGAAATACGGAACTCAGGGAGTGCCAGCCGCAGTGACCCAGTCACCCTGA
ATCTCCTCCATGGTCCAGACCTCCCCAGAATTCACCCTTCATACACCAATTACCGTTCAGGAGATAACCT
CTACTTGTCTTGCTTCGCGAACTCTAACCCACCGGCACAGTATTCTTGGACAATTAATGGGAAGTTTCAG
CAATCAGGACAAAATCTGTTTATCCCCCAAATTACTACAAAGCATAGCGGGCTCTATGTTTGCTCTGTTC
GTAACTCAGCCACTGGCGAGGAAAGCTCCACGTCGTTGACAGTCAAAGTCTCTGCTTCTACAAGAATAGG
ACTTCTTCCTCTCCTTAATCCAACA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC204743 protein sequence
Red=Cloning site Green=Tags(s)

MGPLSAPPCTEHIKWKGLLLTASLLNFWNLPTTAQVTIEAQPPKVSEGKDVLLLVHNLPQNLTGYIWYKG
QIRDLYHYITSYVVDGQIIIYGPAYSGRETAYSNASLLIQNVTREDAGSYTLHIIKRGDGTRGVTGYFTF
TLYLETPKPSISSSNLNPREAMETVILTCDPETPDTSYQWWMNGQSLPMTHRFQLSETNRTLFLFGVTKY
TAGPYECEIRNSGSASRSDPVTLNLLHGPDLPRIHPSYTNYRSGDNLYLSCFANSNPPAQYSWTINGKFQ
QSGQNLFIPQITTKHSGLYVCSVRNSATGEESSTSLTVKVSASTRIGLLPLLNPT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_031246
ORF Size 1005 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_031246.4
RefSeq Size 1612 bp
RefSeq ORF 1008 bp
Locus ID 5670
UniProt ID P11465, A0A024R0M4
Cytogenetics 19q13.31
Domains ig, IG, IGc2
Protein Families Secreted Protein
MW 37.2 kDa
Summary The human pregnancy-specific glycoproteins (PSGs) are a family of proteins that are synthesized in large amounts by placental trophoblasts and released into the maternal circulation during pregnancy. Molecular cloning and analysis of several PSG genes has indicated that the PSGs form a subgroup of the carcinoembryonic antigen (CEA) gene family, which belongs to the immunoglobulin superfamily of genes. Members of the CEA family consist of a single N domain, with structural similarity to the immunoglobulin variable domains, followed by a variable number of immunoglobulin constant-like A and/or B domains. Most PSGs have an arg-gly-asp (RGD) motif, which has been shown to function as an adhesion recognition signal for several integrins, in the N-terminal domain (summary by Teglund et al., 1994 PubMed 7851896). For additional general information about the PSG gene family, see PSG1 (MIM 176390).supplied by OMIM, Oct 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_031246" in other vectors (5)
SKU Description Size Price
RC204743L3 Lenti ORF clone of Human pregnancy specific beta-1-glycoprotein 2 (PSG2), Myc-DDK-tagged 10 ug
$757.00
RC204743L4 Lenti ORF clone of Human pregnancy specific beta-1-glycoprotein 2 (PSG2), mGFP tagged 10 ug
$757.00
RG204743 PSG2 (tGFP-tagged) - Human pregnancy specific beta-1-glycoprotein 2 (PSG2) 10 ug
$489.00 $657.00
SC107858 PSG2 (untagged)-Human pregnancy specific beta-1-glycoprotein 2 (PSG2) 10 ug
$457.00
SC321119 PSG2 (untagged)-Human pregnancy specific beta-1-glycoprotein 2 (PSG2) 10 ug
$457.00

Plasmid Map for RC204743

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC204743
Circular map for RC204743

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products