OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Syndecan 4 (SDC4) (NM_002999) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC204619
SDC4 (Myc-DDK-tagged)-Human syndecan 4 (SDC4)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
  $450.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA314520 Rabbit polyclonal Syndecan4 (Ab-179) antibody
100 ul
$380.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Syndecan 4 or NM_002999"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Syndecan 4
Synonyms SYND4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204619 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCCCGCCCGTCTGTTCGCGCTGCTGCTGTTCTTCGTAGGCGGAGTCGCCGAGTCGATCCGAGAGA
CTGAGGTCATCGACCCCCAGGACCTCCTAGAAGGCCGATACTTCTCCGGAGCCCTACCAGACGATGAGGA
TGTAGTGGGGCCCGGGCAGGAATCTGATGACTTTGAGCTGTCTGGCTCTGGAGATCTGGATGACTTGGAA
GACTCCATGATCGGCCCTGAAGTTGTCCATCCCTTGGTGCCTCTAGATAACCATATCCCTGAGAGGGCAG
GGTCTGGGAGCCAAGTCCCCACCGAACCCAAGAAACTAGAGGAGAATGAGGTTATCCCCAAGAGAATCTC
ACCCGTTGAAGAGAGTGAGGATGTGTCCAACAAGGTGTCAATGTCCAGCACTGTGCAGGGCAGCAACATC
TTTGAGAGAACGGAGGTCCTGGCAGCTCTGATTGTGGGTGGCATCGTGGGCATCCTCTTTGCCGTCTTCC
TGATCCTACTGCTCATGTACCGTATGAAGAAGAAGGATGAAGGCAGCTATGACCTGGGCAAGAAACCCAT
CTACAAGAAAGCCCCCACCAATGAGTTCTACGCG

AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC204619 protein sequence
Red=Cloning site Green=Tags(s)

MAPARLFALLLFFVGGVAESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLE
DSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNI
FERTEVLAALIVGGIVGILFAVFLILLLMYRMKKKDEGSYDLGKKPIYKKAPTNEFYA

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-RsrII Cloning Scheme for this gene | Plasmid Map
ACCN NM_002999
ORF Size 594 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002999.4
RefSeq Size 2615 bp
RefSeq ORF 597 bp
Locus ID 6385
UniProt ID P31431
Cytogenetics 20q13.12
Protein Families Druggable Genome, Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), ECM-receptor interaction
MW 21.6 kDa
Summary The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan that functions as a receptor in intracellular signaling. The encoded protein is found as a homodimer and is a member of the syndecan proteoglycan family. This gene is found on chromosome 20, while a pseudogene has been found on chromosome 22. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_002999" in other vectors (6)
SKU Description Size Price
RC204619L1 Lenti ORF clone of Human syndecan 4 (SDC4), Myc-DDK-tagged 10 ug
$750.00
RC204619L2 Lenti ORF clone of Human syndecan 4 (SDC4), mGFP tagged 10 ug
$750.00
RC204619L3 Lenti ORF clone of Human syndecan 4 (SDC4), Myc-DDK-tagged 10 ug
$750.00
RC204619L4 Lenti ORF clone of Human syndecan 4 (SDC4), mGFP tagged 10 ug
$750.00
RG204619 SDC4 (tGFP-tagged) - Human syndecan 4 (SDC4) 10 ug
$489.00 $650.00
SC118273 SDC4 (untagged)-Human syndecan 4 (SDC4) 10 ug
$300.00

Plasmid Map for RC204619

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC204619
Circular map for RC204619

file-alt Citations

SDC4 Gene Silencing Favors Human Papillary Thyroid Carcinoma Cell Apoptosis and Inhibits Epithelial Mesenchymal Transition via Wnt/β-Catenin Pathway
Chen, Gao, Shen et al
Mol. Cells (2018) 41 (9), 853-867 DOI: 10.14348/molcells.2018.0103
AI Summary: OriGene's SDC4 over-expression plasmids were used to transfect papillary thyroid carcinoma cells, enabling the study of how SDC4 gene modulation affects cell apoptosis, migration, and the Wnt/β-catenin signaling pathway.
Snippet: The two selected PTC cell lines were transfected and assigned into the blank (cells without any transfection), negative control (NC) (cells transfected with nonsense negative sequences), SDC4 over-expression (cells transfected with SDC4 over-expression plasmids, Beijing OriGene Biotechnology Co., Ltd., China), si-SDC4 (cells transfected with SDC4 interference plasmids), si-β-catenin (cells transfected with β-catenin interference plasmids), SDC4 over-expression + si-NC (cells transfected with SDC4 over-expression + nonsense negative sequences)
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products