OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GTF3C6 (NM_138408) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC204285
GTF3C6 (Myc-DDK-tagged)-Human general transcription factor IIIC, polypeptide 6, alpha 35kDa (GTF3C6)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA376864 GTF3C6 Rabbit polyclonal Antibody
100 ul
$410.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "GTF3C6 or NM_138408"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GTF3C6
Synonyms bA397G5.3; C6orf51; TFIIIC35
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204285 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGGCGGCGGACGAGCGGAGTCCAGAGGACGGAGAAGACGAGGAAGAGGAGGAGCAGTTGGTTC
TGGTGGAATTATCAGGAATTATTGATTCAGACTTCCTCTCAAAATGTGAAAATAAATGCAAGGTTTTGGG
CATTGACACTGAGAGGCCCATTCTGCAAGTGGACAGCTGTGTCTTTGCTGGGGAGTATGAAGACACTCTA
GGGACCTGTGTTATATTTGAAGAAAATGTTGAACATGCTGATACAGAAGGCAATAATAAAACAGTGCTAA
AATATAAATGCCATACAATGAAGAAGCTCAGCATGACAAGAACTCTCCTGACAGAGAAGAAGGAAGGAGA
AGAAAACATAGGTGGGGTGGAATGGCTGCAAATAAAGGATAATGATTTCTCCTATCGACCCAACATGATT
TGTAACTTTCTACATGAAAATGAAGACGAAGAAGTGGTAGCTTCAGCCCCAGATAAATCTTTGGAATTGG
AAGAGGAAGAGATTCAAATGAACGACAGTTCAAACCTGAGTTGTGAACAGGAGAAACCAATGCACTTGGA
AATAGAAGATTCTGGTCCTCTTATTGATATACCTTCTGAGACAGAAGGTTCTGTTTTTATGGAAACTCAA
ATGCTGCCT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC204285 protein sequence
Red=Cloning site Green=Tags(s)

MAAAADERSPEDGEDEEEEEQLVLVELSGIIDSDFLSKCENKCKVLGIDTERPILQVDSCVFAGEYEDTL
GTCVIFEENVEHADTEGNNKTVLKYKCHTMKKLSMTRTLLTEKKEGEENIGGVEWLQIKDNDFSYRPNMI
CNFLHENEDEEVVASAPDKSLELEEEEIQMNDSSNLSCEQEKPMHLEIEDSGPLIDIPSETEGSVFMETQ
MLP

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_138408
ORF Size 639 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_138408.4
RefSeq Size 957 bp
RefSeq ORF 642 bp
Locus ID 112495
UniProt ID Q969F1
Cytogenetics 6q21
MW 24 kDa
Summary RNA polymerases are unable to initiate RNA synthesis in the absence of additional proteins called general transcription factors (GTFs). GTFs assemble in a complex on the DNA promoter and recruit the RNA polymerase. GTF3C family proteins (e.g., GTF3C1, MIM 603246) are essential for RNA polymerase III to make a number of small nuclear and cytoplasmic RNAs, including 5S RNA (MIM 180420), tRNA, and adenovirus-associated (VA) RNA of both cellular and viral origin.supplied by OMIM, Mar 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_138408" in other vectors (4)
SKU Description Size Price
RC204285L3 Lenti ORF clone of Human general transcription factor IIIC, polypeptide 6, alpha 35kDa (GTF3C6), Myc-DDK-tagged 10 ug
$600.00
RC204285L4 Lenti ORF clone of Human general transcription factor IIIC, polypeptide 6, alpha 35kDa (GTF3C6), mGFP tagged 10 ug
$600.00
RG204285 GTF3C6 (tGFP-tagged) - Human general transcription factor IIIC, polypeptide 6, alpha 35kDa (GTF3C6) 10 ug
$489.00 $500.00
SC319898 GTF3C6 (untagged)-Human general transcription factor IIIC, polypeptide 6, alpha 35kDa (GTF3C6) 10 ug
$300.00

Plasmid Map for RC204285

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC204285
Circular map for RC204285

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products