OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD43 (SPN) (NM_003123) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC204195
SPN (Myc-DDK-tagged)-Human sialophorin (SPN), transcript variant 2
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA800785 SPN (CD43) mouse monoclonal antibody, clone OTI6A4 (formerly 6A4) 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "CD43 or NM_003123"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CD43
Synonyms CD43; GALGP; GPL115; LSN
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204195 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCACGCTTCTCCTTCTCCTTGGGGTGCTGGTGGTAAGCCCAGACGCTCTGGGGAGCACAACAGCAG
TGCAGACACCCACCTCCGGAGAGCCTTTGGTCTCTACTAGCGAGCCCCTGAGCTCAAAGATGTACACCAC
TTCAATAACAAGTGACCCTAAGGCCGACAGCACTGGGGACCAGACCTCAGCCCTACCTCCCTCAACTTCC
ATCAATGAGGGATCCCCTCTTTGGACTTCCATTGGTGCCAGCACTGGTTCCCCTTTACCTGAGCCAACAA
CCTACCAGGAAGTTTCCATCAAGATGTCATCAGTGCCCCAGGAAACCCCTCATGCAACCAGTCATCCTGC
TGTTCCCATAACAGCAAACTCTCTAGGATCCCACACCGTGACAGGTGGAACCATAACAACGAACTCTCCA
GAAACCTCCAGTAGGACCAGTGGAGCCCCTGTTACCACGGCAGCTAGCTCTCTGGAGACCTCCAGAGGCA
CCTCTGGACCCCCTCTTACCATGGCAACTGTCTCTCTGGAGACTTCCAAAGGCACCTCTGGACCCCCTGT
TACCATGGCAACTGACTCTCTGGAGACCTCCACTGGGACCACTGGACCCCCTGTTACCATGACAACTGGC
TCTCTGGAGCCCTCCAGCGGGGCCAGTGGACCCCAGGTCTCTAGCGTAAAACTATCTACAATGATGTCTC
CAACGACCTCCACCAACGCAAGCACTGTGCCCTTCCGGAACCCAGATGAGAACTCACGAGGCATGCTGCC
AGTGGCTGTGCTTGTGGCCCTGCTGGCGGTCATAGTCCTCGTGGCTCTGCTCCTGCTGTGGCGCCGGCGG
CAGAAGCGGCGGACTGGGGCCCTCGTGCTGAGCAGAGGCGGCAAGCGTAACGGGGTGGTGGACGCCTGGG
CTGGGCCAGCCCAGGTCCCTGAGGAGGGGGCCGTGACAGTGACCGTGGGAGGGTCCGGGGGCGACAAGGG
CTCTGGGTTCCCCGATGGGGAGGGGTCTAGCCGTCGGCCCACGCTCACCACTTTCTTTGGCAGACGGAAG
TCTCGCCAGGGCTCCCTGGCGATGGAGGAGCTGAAGTCTGGGTCAGGCCCCAGCCTCAAAGGGGAGGAGG
AGCCACTGGTGGCCAGTGAGGATGGGGCTGTGGACGCCCCAGCTCCTGATGAGCCCGAAGGGGGAGACGG
GGCTGCCCCT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC204195 protein sequence
Red=Cloning site Green=Tags(s)

MATLLLLLGVLVVSPDALGSTTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTS
INEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSP
ETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTG
SLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRR
QKRRTGALVLSRGGKRNGVVDAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRK
SRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAP

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_003123
ORF Size 1200 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003123.6
RefSeq Size 6911 bp
RefSeq ORF 1203 bp
Locus ID 6693
UniProt ID P16150, A0A024R629
Cytogenetics 16p11.2
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Cell adhesion molecules (CAMs)
MW 40.3 kDa
Summary This gene encodes a highly sialylated glycoprotein that functions in antigen-specific activation of T cells, and is found on the surface of thymocytes, T lymphocytes, monocytes, granulocytes, and some B lymphocytes. It contains a mucin-like extracellular domain, a transmembrane region and a carboxy-terminal intracellular region. The extracellular domain has a high proportion of serine and threonine residues, allowing extensive O-glycosylation, and has one potential N-glycosylation site, while the carboxy-terminal region has potential phosphorylation sites that may mediate transduction of activation signals. Different glycoforms of this protein have been described. In stimulated immune cells, proteolytic cleavage of the extracellular domain occurs in some cell types, releasing a soluble extracellular fragment. Defects in expression of this gene are associated with Wiskott-Aldrich syndrome. provided by RefSeq, Sep 2017
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_003123" in other vectors (7)
SKU Description Size Price
RC204195L1 Lenti ORF clone of Human sialophorin (SPN), transcript variant 2, Myc-DDK-tagged 10 ug
$757.00
RC204195L2 Lenti ORF clone of Human sialophorin (SPN), transcript variant 2, mGFP tagged 10 ug
$757.00
RC204195L3 Lenti ORF clone of Human sialophorin (SPN), transcript variant 2, Myc-DDK-tagged 10 ug
$757.00
RC204195L4 Lenti ORF clone of Human sialophorin (SPN), transcript variant 2, mGFP tagged 10 ug
$757.00
RG204195 SPN (tGFP-tagged) - Human sialophorin (SPN), transcript variant 2 10 ug
$489.00 $657.00
SC118170 SPN (untagged)-Human sialophorin (SPN), transcript variant 2 10 ug
$457.00
SC320913 SPN (untagged)-Human sialophorin (SPN), transcript variant 2 10 ug
$457.00

Plasmid Map for RC204195

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC204195
Circular map for RC204195

file-alt Citations

Dimerization of sortilin regulates its trafficking to extracellular vesicles
Itoh, Mizuno, Aikawa et al
J. Biol. Chem. (2018)
AI Summary: OriGene’s CD43 expression vector (Cat# RC204195, NM_003123) was used to generate constructs for studying sortilin trafficking and dimerization in this paper.
Snippet: Constructs of sortilin CD43-TMD were generated by overlapping PCR strategy using a CD43 expression vector (Origene, Cat#RC204195, NM_003123) (26): pcDNA3.1(+) FLAG-sortilin CD43-TMD, sortilin aa1-831 (∆755-778) with CD43 aa254- 276;pcDNA3.1(+) 6XHis
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products