OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DULLARD (CTDNEP1) (NM_015343) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC203657
CTDNEP1 (Myc-DDK-tagged)-Human CTD nuclear envelope phosphatase 1 (CTDNEP1), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA341969 Rabbit Polyclonal Anti-DULLARD Antibody
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "DULLARD or NM_015343"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DULLARD
Synonyms DULLARD; HSA011916; NET56
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203657 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGCGGACGCAGTGTCTGCTGGGGCTGCGCACGTTCGTGGCCTTCGCCGCCAAGCTCTGGAGCTTCT
TCATTTACCTTTTGCGGAGGCAGATCCGCACGGTAATTCAGTACCAAACTGTTCGATATGATATCCTCCC
CTTATCTCCTGTGTCCCGGAATCGGCTAGCCCAGGTGAAGAGGAAGATCCTGGTGCTGGATCTGGATGAG
ACACTTATTCACTCCCACCATGATGGGGTCCTGAGGCCCACAGTCCGGCCTGGTACGCCTCCTGACTTCA
TCCTCAAGGTGGTAATAGACAAACATCCTGTCCGGTTTTTTGTACATAAGAGGCCCCATGTGGATTTCTT
CCTGGAAGTGGTGAGCCAGTGGTACGAGCTGGTGGTGTTTACAGCAAGCATGGAGATCTATGGCTCTGCT
GTGGCAGATAAACTGGACAATAGCAGAAGCATTCTTAAGAGGAGATATTACAGACAGCACTGCACTTTGG
AGTTGGGCAGCTACATCAAGGACCTCTCTGTGGTCCACAGTGACCTCTCCAGCATTGTGATCCTGGATAA
CTCCCCAGGGGCTTACAGGAGCCATCCAGACAATGCCATCCCCATCAAATCCTGGTTCAGTGACCCCAGC
GACACAGCCCTTCTCAACCTGCTCCCAATGCTGGATGCCCTCAGGTTCACCGCTGATGTTCGTTCCGTGC
TGAGCCGAAACCTTCACCAACATCGGCTCTGG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC203657 protein sequence
Red=Cloning site Green=Tags(s)

MMRTQCLLGLRTFVAFAAKLWSFFIYLLRRQIRTVIQYQTVRYDILPLSPVSRNRLAQVKRKILVLDLDE
TLIHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEVVSQWYELVVFTASMEIYGSA
VADKLDNSRSILKRRYYRQHCTLELGSYIKDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPS
DTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_015343
ORF Size 732 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_015343.3, NP_056158.2
RefSeq Size 1780 bp
RefSeq ORF 735 bp
Locus ID 23399
UniProt ID O95476
Cytogenetics 17p13.1
Domains CPDc
Protein Families Transmembrane
MW 28.4 kDa
Summary Serine/threonine protein phosphatase forming with CNEP1R1 an active phosphatase complex that dephosphorylates and may activate LPIN1 and LPIN2. LPIN1 and LPIN2 are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol and control the metabolism of fatty acids at different levels. May indirectly modulate the lipid composition of nuclear and/or endoplasmic reticulum membranes and be required for proper nuclear membrane morphology and/or dynamics. May also indirectly regulate the production of lipid droplets and triacylglycerol. May antagonize BMP signaling.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_015343" in other vectors (6)
SKU Description Size Price
RC203657L1 Lenti ORF clone of Human CTD nuclear envelope phosphatase 1 (CTDNEP1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC203657L2 Lenti ORF clone of Human CTD nuclear envelope phosphatase 1 (CTDNEP1), transcript variant 1, mGFP tagged 10 ug
$600.00
RC203657L3 Lenti ORF clone of Human CTD nuclear envelope phosphatase 1 (CTDNEP1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC203657L4 Lenti ORF clone of Human CTD nuclear envelope phosphatase 1 (CTDNEP1), transcript variant 1, mGFP tagged 10 ug
$600.00
RG203657 CTDNEP1 (tGFP-tagged) - Human CTD nuclear envelope phosphatase 1 (CTDNEP1), transcript variant 1 10 ug
$489.00 $500.00
SC114718 CTDNEP1 (untagged)-Human CTD nuclear envelope phosphatase 1 (CTDNEP1), transcript variant 1 10 ug
$300.00

Plasmid Map for RC203657

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC203657
Circular map for RC203657

file-alt Citations

p53 ensures the normal behavior and modification of G1/S-specific histone H3.1 in the nucleus
Oikawa, Hasegawa, Handa et al
Life Sci Alliance (2024) 7 (9) DOI: 10.26508/lsa.202402835
Cited by 3
AI Summary: In this study, OriGene products—specifically the Myc-FLAG-tagged cDNAs for CTDNEP1 (#RC203657), NEP1R1 (#RC235833), and TMEM255A (#RC207956)—were used to express these proteins in cells to investigate their roles in the regulation of histone H3.1 behavior and modification during the G1/S phase.
Snippet: V-G (Clontech) using Lipofectamine LTX reagent (Invitrogen), following the manufacturer’s instructions. cDNAs encoding CTDNEP1, NEP1R1, and TMEM255A followed by the Myc-FLAG tag were purchased from OriGene (#RC203657, #RC235833, and #RC207956, respectively). To produce the Q2 domain of the Opi1 protein tagged with GST, a cDNA encoding the Q2 domain of Opi1 (a gift from Dr. Alwin Köhler, Univers
FigureFigureFigure
p53 controls the nuclear entry and epigenetic modification of H3.1 by downregulating nuclear phosphatidic acid
Oikawa, Hasegawa, Ohnishi et al
bioRxiv (2023)
Snippet: … cDNAs encoding CTDNEP1, NEP1R1, and TMEM255A followed by Myc-FLAG tag were purchased from Origene (cat. no. RC203657, RC235833, and RC207956, respectively)
Peripheral Inhibition of Small C‐Terminal Domain Phosphatase 1 With Napthoquinone Analogs
Rallabandi, Lee, Sung et al
Bull. Korean Chem. Soc. (2020) 41 (6), 657-664 DOI: 10.1002/bkcs.12051
Cited by 2
AI Summary: OriGene provided the cDNAs of human SCP1 and Dullard, which were used in the experiments described in the paper.
Snippet: Experimental. Materials. cDNAs of human SCP1 and Dullard were obtained from OriGene (Rockville, MD). Novablue Gigasingle competent cells and Rosetta 2 (DE3) competent cells were purchased from EMD Bioscience (Darmstadt, Germany)
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products