OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NUDT6 (NM_007083) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC203470
NUDT6 (Myc-DDK-tagged)-Human nudix (nucleoside diphosphate linked moiety X)-type motif 6 (NUDT6), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA502343 NUDT6 mouse monoclonal antibody, clone OTI9D12 (formerly 9D12) 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "NUDT6 or NM_007083"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NUDT6
Synonyms ASFGF2; FGF-AS; FGF2AS; GFG-1; GFG1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203470 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGGCAGCCGCTGAGCTGGGGCCGCTGGCGCGCGATGCTTGCCCGAACCTACGGCCCCGGGCCTTCGG
CGGGTTACCGCTGGGCCTCGGGCGCACAGGGTTACGTGCGGAATCCGCCAGTTGGAGCGTGCGATCTGCA
GGGCGAGCTGGACAGATTCGGGGGCATCTCGGTGCGCCTGGCGCGGCTCGATGCGCTGGACCGCCTGGAC
GCTGCCGCCTTCCAGAAGGGCTTGCAGGCTGCAGTACAGCAATGGCGATCAGAAGGTAGAACAGCTGTAT
GGCTGCACATTCCCATCCTCCAAAGCCGATTTATTGCCCCTGCTGCTTCCCTGGGCTTCTGCTTTCACCA
CGCAGAATCGGATTCATCAACGTTGACTCTGTGGCTGAGAGAAGGGCCCAGCAGATTACCAGGATATGCT
TCACATCAAGTAGGAGTTGCAGGAGCTGTATTTGATGAAAGTACTAGAAAAATACTGGTTGTACAAGATC
GAAATAAATTGAAAAATATGTGGAAGTTTCCAGGAGGCCTGTCAGAGCCTGAAGAAGATATTGGAGACAC
AGCGGTTCGAGAAGTTTTTGAAGAGACTGGTATAAAATCAGAATTCAGGTCCGTCCTGAGTATTCGGCAA
CAGCACACAAATCCTGGAGCTTTTGGGAAGTCAGATATGTATATCATCTGCCGCCTAAAGCCATATTCAT
TCACCATAAATTTTTGCCAGGAAGAATGCTTAAGATGTGAGTGGATGGATCTCAATGACCTGGCGAAGAC
TGAAAATACAACTCCCATCACCAGCAGAGTTGCTAGGCTGCTGCTGTATGGGTACAGAGAAGGGTTTGAC
AAAATTGACCTGACTGTGGAAGAACTTCCAGCAGTTTACACAGGACTGTTTTATAAACTCTATCATAAGG
AACTGCCAGAGAATTATAAAACTATGAAAGGAATTGAT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC203470 protein sequence
Red=Cloning site Green=Tags(s)

MRQPLSWGRWRAMLARTYGPGPSAGYRWASGAQGYVRNPPVGACDLQGELDRFGGISVRLARLDALDRLD
AAAFQKGLQAAVQQWRSEGRTAVWLHIPILQSRFIAPAASLGFCFHHAESDSSTLTLWLREGPSRLPGYA
SHQVGVAGAVFDESTRKILVVQDRNKLKNMWKFPGGLSEPEEDIGDTAVREVFEETGIKSEFRSVLSIRQ
QHTNPGAFGKSDMYIICRLKPYSFTINFCQEECLRCEWMDLNDLAKTENTTPITSRVARLLLYGYREGFD
KIDLTVEELPAVYTGLFYKLYHKELPENYKTMKGID

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_007083
ORF Size 948 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007083.2
RefSeq Size 1197 bp
RefSeq ORF 951 bp
Locus ID 11162
UniProt ID P53370
Cytogenetics 4q28.1
Domains NUDIX
MW 35.7 kDa
Summary This gene overlaps and lies on the opposite strand from FGF2 gene, and is thought to be the FGF2 antisense gene. The two genes are independently transcribed, and their expression shows an inverse relationship, suggesting that this antisense transcript may regulate FGF2 expression. This gene has also been shown to have hormone-regulatory and antiproliferative actions in the pituitary that are independent of FGF2 expression. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Oct 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_007083" in other vectors (6)
SKU Description Size Price
RC203470L1 Lenti ORF clone of Human nudix (nucleoside diphosphate linked moiety X)-type motif 6 (NUDT6), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC203470L2 Lenti ORF clone of Human nudix (nucleoside diphosphate linked moiety X)-type motif 6 (NUDT6), transcript variant 1, mGFP tagged 10 ug
$600.00
RC203470L3 Lenti ORF clone of Human nudix (nucleoside diphosphate linked moiety X)-type motif 6 (NUDT6), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC203470L4 Lenti ORF clone of Human nudix (nucleoside diphosphate linked moiety X)-type motif 6 (NUDT6), transcript variant 1, mGFP tagged 10 ug
$600.00
RG203470 NUDT6 (tGFP-tagged) - Human nudix (nucleoside diphosphate linked moiety X)-type motif 6 (NUDT6), transcript variant 1 10 ug
$489.00 $500.00
SC315525 NUDT6 (untagged)-Human nudix (nucleoside diphosphate linked moiety X)-type motif 6 (NUDT6), transcript variant 1 10 ug
$330.00

Plasmid Map for RC203470

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC203470
Circular map for RC203470

file-alt Citations

The involvement of non-coding RNAs in smooth muscle cell dynamics in atherosclerosis and abdominal aortic aneurysm
Winter
Thesis (2023)
Snippet: EV plasmid PS100001 Origene (Rockville, MD, USA) GFP plasmid gifted Dr. Francesca Fasolo DH5a competent cells 18263-012 Sigma Aldrich (St.Louis, MO, USA) NUDT6 plasmid RC203470 Origene (Rockville, MD, USA) NUDT6 sirna 122202 Thermo Fisher Scientific
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products