OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HIP55 (DBNL) (NM_014063) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC203435
DBNL (Myc-DDK-tagged)-Human drebrin-like (DBNL), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "HIP55 or NM_014063"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HIP55
Synonyms ABP1; HIP-55; HIP55; SH3P7
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203435 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGAACCTGAGCCGGAACGGGCCAGCGCTGCAAGAGGCCTACGTGCGGGTGGTCACCGAGAAGT
CCCCGACCGACTGGGCTCTCTTTACCTATGAAGGCAACAGCAATGACATCCGCGTGGCTGGCACAGGGGA
GGGTGGCCTGGAGGAGATGGTGGAGGAGCTCAACAGCGGGAAGGTGATGTACGCCTTCTGCAGAGTGAAG
GACCCCAACTCTGGACTGCCCAAATTTGTCCTCATCAACTGGACAGGCGAGGGCGTGAACGATGTGCGGA
AGGGAGCCTGTGCCAGCCACGTCAGCACCATGGCCAGCTTCCTGAAGGGGGCCCATGTGACCATCAACGC
ACGGGCCGAGGAGGATGTGGAGCCTGAGTGCATCATGGAGAAGGTGGCCAAGGCTTCAGGTGCCAACTAC
AGCTTTCACAAGGAGAGTGGCCGCTTCCAGGACGTGGGACCCCAGGCCCCAGTGGGCTCTGTGTACCAGA
AGACCAATGCCGTGTCTGAGATTAAAAGGGTTGGTAAAGACAGCTTCTGGGCCAAAGCAGAGAAGGAGGA
GGAGAACCGTCGGCTGGAGGAAAAGCGGCGGGCCGAGGAGGCACAGCGGCAGCTGGAGCAGGAGCGCCGG
GAGCGTGAGCTGCGTGAGGCTGCACGCCGGGAGCAGCGCTATCAGGAGCAGGGTGGCGAGGCCAGCCCCC
AGAGCAGGACGTGGGAGCAGCAGCAAGAAGTGGTTTCAAGGAACCGAAATGAGCAGGAGTCTGCCGTGCA
CCCGAGGGAGATTTTCAAGCAGAAGGAGAGGGCCATGTCCACCACCTCCATCTCCAGTCCTCAGCCTGGC
AAGCTGAGGAGCCCCTTCCTGCAGAAGCAGCTCACCCAACCAGAGACCCACTTTGGCAGAGAGCCAGCTG
CTGCCATCTCAAGGCCCAGGGCAGATCTCCCTGCTGAGGAGCCGGCGCCCAGCACTCCTCCATGTCTGGT
GCAGGCAGAAGAGGAGGCTGTGTATGAGGAACCTCCAGAGCAGGAGACCTTCTACGAGCAGCCCCCACTG
GTGCAGCAGCAAGGTGCTGGCTCTGAGCACATTGACCACCACATTCAGGGCCAGGGGCTCAGTGGGCAAG
GGCTCTGTGCCCGTGCCCTGTACGACTACCAGGCAGCCGACGACACAGAGATCTCCTTTGACCCCGAGAA
CCTCATCACGGGCATCGAGGTGATCGACGAAGGCTGGTGGCGTGGCTATGGGCCGGATGGCCATTTTGGC
ATGTTCCCTGCCAACTACGTGGAGCTCATTGAG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC203435 protein sequence
Red=Cloning site Green=Tags(s)

MAANLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEEMVEELNSGKVMYAFCRVK
DPNSGLPKFVLINWTGEGVNDVRKGACASHVSTMASFLKGAHVTINARAEEDVEPECIMEKVAKASGANY
SFHKESGRFQDVGPQAPVGSVYQKTNAVSEIKRVGKDSFWAKAEKEEENRRLEEKRRAEEAQRQLEQERR
ERELREAARREQRYQEQGGEASPQSRTWEQQQEVVSRNRNEQESAVHPREIFKQKERAMSTTSISSPQPG
KLRSPFLQKQLTQPETHFGREPAAAISRPRADLPAEEPAPSTPPCLVQAEEEAVYEEPPEQETFYEQPPL
VQQQGAGSEHIDHHIQGQGLSGQGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGPDGHFG
MFPANYVELIE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_014063
ORF Size 1293 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014063.7
RefSeq Size 2213 bp
RefSeq ORF 1296 bp
Locus ID 28988
UniProt ID Q9UJU6
Cytogenetics 7p13
Domains ADF, SH3
MW 48.3 kDa
Summary Adapter protein that binds F-actin and DNM1, and thereby plays a role in receptor-mediated endocytosis. Plays a role in the reorganization of the actin cytoskeleton, formation of cell projections, such as neurites, in neuron morphogenesis and synapse formation via its interaction with WASL and COBL. Does not bind G-actin and promote actin polymerization by itself. Required for the formation of organized podosome rosettes (By similarity). May act as a common effector of antigen receptor-signaling pathways in leukocytes. Acts as a key component of the immunological synapse that regulates T-cell activation by bridging TCRs and the actin cytoskeleton to gene activation and endocytic processes.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_014063" in other vectors (6)
SKU Description Size Price
RC203435L1 Lenti ORF clone of Human drebrin-like (DBNL), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC203435L2 Lenti ORF clone of Human drebrin-like (DBNL), transcript variant 1, mGFP tagged 10 ug
$757.00
RC203435L3 Lenti ORF clone of Human drebrin-like (DBNL), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC203435L4 Lenti ORF clone of Human drebrin-like (DBNL), transcript variant 1, mGFP tagged 10 ug
$757.00
RG203435 DBNL (tGFP-tagged) - Human drebrin-like (DBNL), transcript variant 1 10 ug
$489.00 $657.00
SC319311 DBNL (untagged)-Human drebrin-like (DBNL), transcript variant 1 10 ug
$457.00

Plasmid Map for RC203435

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC203435
Circular map for RC203435

file-alt Citations

Autoantibodies in small fiber neuropathy: frequency and clinical features associated with antibodies to the novel targets MX1 and DBNL
Morelli, Ricciardiello, Furia et al
J Neurol (2026) 273 (8) DOI: 10.1007/s00415-026-13995-8
AI Summary: OriGene’s full-length human MX1 (CAT#: RC227878), DBNL (CAT#: RC203435), and KRT8 (CAT#: RC209570) plasmids were used to transfect HEK293T cells for cell-based assays to detect autoantibodies in patient sera, enabling identification of novel autoantibody targets in small fiber neuropathy.
Snippet: nd IgG isotypesFixed CBA for MX1, DBNL, and KRT8 antibody detectionHEK293T cells were transfected with full-length plasmids encoding for human MX1 (Origene, CAT#: RC227878), DBNL (Origene, CAT#: RC203435), or KRT8 (Origene, CAT#: RC209570). The green fluorescent protein (EGFP) was co-transfected to confirm transfection efficiency
FigureFigureFigure
Developing and improving assays to detect autoantibodies in well phenotyped small fiber neuropathy and fibromyalgia syndrome patients
Singh
Oxford University Research Archive (2026)
AI Summary: OriGene contributed plasmids encoding FGFR3 (RC215533), Plexin D1 (RC216518), MX1 (RC227878), KRT8 (RC209570), and DBNL (RC203435), which were essential for developing and performing the cell-based assays to detect autoantibodies in small fiber neuropathy and fibromyalgia patients.
Snippet: Plasmids with cDNA encoding FGFR3, Plexin D1, MX1, KRT8, or DBNL with a SV40 origin of replication, a Myc-tag, and Kanamycin antibiotic resistance were purchased (in respective order RC215533, RC216518, RC227878, RC209570, RC203435;Origene)
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products