OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PBK (NM_018492) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC203295
PBK (Myc-DDK-tagged)-Human PDZ binding kinase (PBK)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA302075 PBK Antibody (C-term C300)
400 ul
$645.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "PBK or NM_018492"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PBK
Synonyms CT84; HEL164; Nori-3; SPK; TOPK
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203295 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAGGGATCAGTAATTTCAAGACACCAAGCAAATTATCAGAAAAAAAGAAATCTGTATTATGTTCAA
CTCCAACTATAAATATCCCGGCCTCTCCATTTATGCAGAAGCTTGGCTTTGGTACTGGGGTAAATGTGTA
CCTAATGAAAAGATCTCCAAGAGGTTTGTCTCATTCTCCTTGGGCTGTAAAAAAGATTAATCCTATATGT
AATGATCATTATCGAAGTGTGTATCAAAAGAGACTAATGGATGAAGCTAAGATTTTGAAAAGCCTTCATC
ATCCAAACATTGTTGGTTATCGTGCTTTTACTGAAGCCAATGATGGCAGTCTGTGTCTTGCTATGGAATA
TGGAGGTGAAAAGTCTCTAAATGACTTAATAGAAGAACGATATAAAGCCAGCCAAGATCCTTTTCCAGCA
GCCATAATTTTAAAAGTTGCTTTGAATATGGCAAGAGGGTTAAAGTATCTGCACCAAGAAAAGAAACTGC
TTCATGGAGACATAAAGTCTTCAAATGTTGTAATTAAAGGCGATTTTGAAACAATTAAAATCTGTGATGT
AGGAGTCTCTCTACCACTGGATGAAAATATGACTGTGACTGACCCTGAGGCTTGTTACATTGGCACAGAG
CCATGGAAACCCAAAGAAGCTGTGGAGGAGAATGGTGTTATTACTGACAAGGCAGACATATTTGCCTTTG
GCCTTACTTTGTGGGAAATGATGACTTTATCGATTCCACACATTAATCTTTCAAATGATGATGATGATGA
AGATAAAACTTTTGATGAAAGTGATTTTGATGATGAAGCATACTATGCAGCGTTGGGAACTAGGCCACCT
ATTAATATGGAAGAACTGGATGAATCATACCAGAAAGTAATTGAACTCTTCTCTGTATGCACTAATGAAG
ACCCTAAAGATCGTCCTTCTGCTGCACACATTGTTGAAGCTCTGGAAACAGATGTC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC203295 protein sequence
Red=Cloning site Green=Tags(s)

MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPIC
NDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPA
AIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTE
PWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPP
INMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_018492
ORF Size 966 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_018492.4
RefSeq Size 2127 bp
RefSeq ORF 969 bp
Locus ID 55872
UniProt ID Q96KB5, V9HWH0
Cytogenetics 8p21.1
Domains pkinase, S_TKc, TyrKc
Protein Families Druggable Genome, Protein Kinase
MW 36.1 kDa
Summary This gene encodes a serine/threonine protein kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. The encoded protein may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis. Overexpression of this gene has been implicated in tumorigenesis. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jul 2013
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_018492" in other vectors (7)
SKU Description Size Price
RC203295L1 Lenti ORF clone of Human PDZ binding kinase (PBK), Myc-DDK-tagged 10 ug
$600.00
RC203295L2 Lenti ORF clone of Human PDZ binding kinase (PBK), mGFP tagged 10 ug
$600.00
RC203295L3 Lenti ORF clone of Human PDZ binding kinase (PBK), Myc-DDK-tagged 10 ug
$600.00
RC203295L4 Lenti ORF clone of Human PDZ binding kinase (PBK), mGFP tagged 10 ug
$600.00
RG203295 PBK (tGFP-tagged) - Human PDZ binding kinase (PBK) 10 ug
$489.00 $500.00
SC113461 PBK (untagged)-Human PDZ binding kinase (PBK) 10 ug
$300.00
SC323480 PBK (untagged)-Kinase deficient mutant (K64M) of Human PDZ binding kinase (PBK) 10 ug
$300.00

Plasmid Map for RC203295

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC203295
Circular map for RC203295

file-alt Citations

4-Hydroxytamoxifen enhances sensitivity of estrogen receptor α-positive breast cancer to docetaxel in an estrogen and ZNF423 SNP-dependent fashion
Wang, Qin, Zayas et al
Breast Cancer Res. Treat. (2019)
AI Summary: OriGene products contributed to this study by providing the VRK1 and PBK plasmids, which were used to transiently overexpress these genes in ZNF423 knockdown cells for rescue experiments.
Snippet: For rescue experiments, cells were reverse transfected with ZNF423 siRNA or control siRNA and allowed to adhere to the plate. Twelve hours later, ZNF423 knockdown cells were transiently overexpressed with the VRK1 or PBK plasmids (Origene, Rockville, MD)
PBK overexpression promotes metastasis of hepatocellular carcinoma via activating ETV4-uPAR signaling pathway
Yang, Zhong, He et al
Cancer Lett. (2019) 452, 90-102 DOI: 10.1016/j.canlet.2019.03.028
AI Summary: OriGene products, specifically the ETV4 expression vector, PBK expression vector, and uPAR expression vector, were used in this study to manipulate gene expression and investigate the roles of these proteins in promoting hepatocellular carcinoma metastasis.
Snippet: respectively. Sequences of shCont is 5'-GCAACAAGATGAAGAGCACCAA- 3'. The plasmids used in our study including ETV4 expression vector, PBK expression vector and uPAR expression vector were obtained from OriGene. Anti;
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products