OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

KCNJ15 (NM_002243) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RC203125
KCNJ15 (Myc-DDK-tagged)-Human potassium inwardly-rectifying channel, subfamily J, member 15 (KCNJ15), transcript variant 2
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "KCNJ15 or NM_002243"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol KCNJ15
Synonyms IRKK; KIR1.3; KIR4.2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203125 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATGCCATTCACATCGGCATGTCCAGCACCCCCCTGGTGAAGCACACTGCTGGGGCTGGGCTCAAGG
CCAACAGACCCCGCGTCATGTCCAAGAGTGGGCACAGCAACGTGAGAATTGACAAAGTGGATGGCATATA
CCTACTCTACCTGCAAGACCTGTGGACCACAGTTATCGACATGAAGTGGAGATACAAACTCACCCTGTTC
GCTGCCACTTTTGTGATGACCTGGTTCCTTTTTGGAGTCATCTACTATGCCATCGCGTTTATTCATGGGG
ACTTAGAACCCGGTGAGCCCATTTCAAATCATACCCCCTGCATCATGAAAGTGGACTCTCTCACTGGGGC
GTTTCTCTTTTCCCTGGAATCCCAGACAACCATTGGCTATGGAGTCCGTTCCATCACAGAGGAATGTCCT
CATGCCATCTTCCTGTTGGTTGCTCAGTTGGTCATCACGACCTTGATTGAGATCTTCATCACCGGAACCT
TCCTGGCCAAAATCGCCAGACCCAAAAAGCGGGCTGAGACCATCAAGTTCAGCCACTGTGCAGTCATCAC
CAAGCAGAATGGGAAGCTGTGCTTGGTGATTCAGGTAGCCAATATGAGGAAGAGCCTCTTGATTCAGTGC
CAGCTCTCTGGCAAGCTCCTGCAGACCCACGTCACCAAGGAGGGGGAGCGGATTCTCCTCAACCAAGCCA
CTGTCAAATTCCACGTGGACTCCTCCTCTGAGAGCCCCTTCCTCATTCTGCCCATGACATTCTACCATGT
GCTGGATGAGACGAGCCCCCTGAGAGACCTCACACCCCAAAACCTAAAGGAGAAGGAGTTTGAGCTTGTG
GTCCTCCTCAATGCCACTGTGGAATCCACCAGCGCTGTCTGCCAGAGCCGAACATCTTATATCCCAGAGG
AAATCTACTGGGGTTTTGAGTTTGTGCCTGTGGTATCTCTCTCCAAAAATGGAAAATATGTGGCTGATTT
CAGTCAGTTTGAACAGATTCGGAAAAGCCCAGATTGCACATTTTACTGTGCAGATTCTGAGAAACAGCAA
CTCGAGGAGAAGTACAGGCAGGAGGATCAGAGGGAAAGAGAACTGAGGACACTTTTATTACAACAGAGCA
ATGTC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC203125 protein sequence
Red=Cloning site Green=Tags(s)

MDAIHIGMSSTPLVKHTAGAGLKANRPRVMSKSGHSNVRIDKVDGIYLLYLQDLWTTVIDMKWRYKLTLF
AATFVMTWFLFGVIYYAIAFIHGDLEPGEPISNHTPCIMKVDSLTGAFLFSLESQTTIGYGVRSITEECP
HAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIKFSHCAVITKQNGKLCLVIQVANMRKSLLIQC
QLSGKLLQTHVTKEGERILLNQATVKFHVDSSSESPFLILPMTFYHVLDETSPLRDLTPQNLKEKEFELV
VLLNATVESTSAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQ
LEEKYRQEDQRERELRTLLLQQSNV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_002243
ORF Size 1125 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002243.5
RefSeq Size 2942 bp
RefSeq ORF 1128 bp
Locus ID 3772
UniProt ID Q99712
Cytogenetics 21q22.13-q22.2
Protein Families Druggable Genome, Ion Channels: Potassium, Transmembrane
MW 42.6 kDa
Summary Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Eight transcript variants encoding the same protein have been found for this gene. provided by RefSeq, Feb 2013
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_002243" in other vectors (6)
SKU Description Size Price
RC203125L1 Lenti ORF clone of Human potassium inwardly-rectifying channel, subfamily J, member 15 (KCNJ15), transcript variant 2, Myc-DDK-tagged 10 ug
$757.00
RC203125L2 Lenti ORF clone of Human potassium inwardly-rectifying channel, subfamily J, member 15 (KCNJ15), transcript variant 2, mGFP tagged 10 ug
$757.00
RC203125L3 Lenti ORF clone of Human potassium inwardly-rectifying channel, subfamily J, member 15 (KCNJ15), transcript variant 2, Myc-DDK-tagged 10 ug
$757.00
RC203125L4 Lenti ORF clone of Human potassium inwardly-rectifying channel, subfamily J, member 15 (KCNJ15), transcript variant 2, mGFP tagged 10 ug
$757.00
RG203125 KCNJ15 (tGFP-tagged) - Human potassium inwardly-rectifying channel, subfamily J, member 15 (KCNJ15), transcript variant 2 10 ug
$489.00 $657.00
SC118712 KCNJ15 (untagged)-Human potassium inwardly-rectifying channel, subfamily J, member 15 (KCNJ15), transcript variant 2 10 ug
$457.00

Plasmid Map for RC203125

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC203125
Circular map for RC203125

file-alt Citations

KCNJ15 Expression and Malignant Behavior of Esophageal Squamous Cell Carcinoma
Nakamura, Kanda, Koike et al
Ann. Surg. Oncol. (2020)
Cited by 21
AI Summary: OriGene products, specifically the pCMV-entry control vector and the pCMV6-entry KCNJ15 expression vector (RC203125), were used to perform forced expression experiments that helped clarify the role of KCNJ15 in esophageal squamous cell carcinoma cell proliferation.
Snippet: understand the role of KCNJ15 in ESCC, we performed the forced expression experiment using the control C-terminal Myc and DDK-Tagged, Destination Vector (pCMV-entry control) and pCMV6-entry KCNJ15 expression vector (RC203125) [OriGene Technoloqies
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products