OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PSF1 (GINS1) (NM_021067) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC203049
GINS1 (Myc-DDK-tagged)-Human GINS complex subunit 1 (Psf1 homolog) (GINS1)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA350941 Rabbit Polyclonal Anti-GINS1 Antibody
100 ul
$205.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "PSF1 or NM_021067"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PSF1
Synonyms IMD55; PSF1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203049 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTCTGCGAAAAAGCCATGGAACTGATCCGCGAGCTGCATCGCGCGCCCGAAGGGCAACTGCCTGCCT
TCAACGAGGATGGACTCAGACAAGTTCTGGAGGAGATGAAAGCTTTGTATGAACAAAACCAGTCTGATGT
GAATGAAGCAAAGTCAGGTGGACGAAGTGATTTGATACCAACTATCAAATTTCGACACTGTTCTCTGTTA
AGAAATCGACGCTGCACTGTAGCATACCTGTATGACCGCTTGCTTCGGATCAGAGCACTCAGATGGGAAT
ATGGTAGCATCTTGCCAAATGCATTACGATTTCACATGGCTGCTGAAGAAATGGAGTGGTTTAATAATTA
TAAAAGATCTCTTGCTACTTATATGAGGTCACTGGGAGGAGATGAAGGTTTGGACATTACACAGGATATG
AAACCACCAAAAAGCCTATATATTGAAGTCCGGTGTCTAAAAGACTATGGAGAATTTGAAGTTGATGATG
GCACTTCAGTCCTATTAAAAAAAAATAGCCAGCACTTTTTACCTCGATGGAAATGTGAGCAGCTGATCAG
ACAAGGAGTCCTGGAGCACATCCTGTCA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC203049 protein sequence
Red=Cloning site Green=Tags(s)

MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLL
RNRRCTVAYLYDRLLRIRALRWEYGSILPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDM
KPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEHILS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_021067
ORF Size 588 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_021067.2, NP_066545.2
RefSeq Size 3289 bp
RefSeq ORF 591 bp
Locus ID 9837
UniProt ID Q14691
Cytogenetics 20p11.21
Domains UPF0080
MW 23 kDa
Summary The yeast heterotetrameric GINS complex is made up of Sld5 (GINS4; MIM 610611), Psf1, Psf2 (GINS2; MIM 610609), and Psf3 (GINS3; MIM 610610). The formation of the GINS complex is essential for the initiation of DNA replication in yeast and Xenopus egg extracts (Ueno et al., 2005 PubMed 16287864).supplied by OMIM, Mar 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_021067" in other vectors (6)
SKU Description Size Price
RC203049L1 Lenti ORF clone of Human GINS complex subunit 1 (Psf1 homolog) (GINS1), Myc-DDK-tagged 10 ug
$600.00
RC203049L2 Lenti ORF clone of Human GINS complex subunit 1 (Psf1 homolog) (GINS1), mGFP tagged 10 ug
$600.00
RC203049L3 Lenti ORF clone of Human GINS complex subunit 1 (Psf1 homolog) (GINS1), Myc-DDK-tagged 10 ug
$600.00
RC203049L4 Lenti ORF clone of Human GINS complex subunit 1 (Psf1 homolog) (GINS1), mGFP tagged 10 ug
$600.00
RG203049 GINS1 (tGFP-tagged) - Human GINS complex subunit 1 (Psf1 homolog) (GINS1) 10 ug
$489.00 $500.00
SC321599 GINS1 (untagged)-Human GINS complex subunit 1 (Psf1 homolog) (GINS1) 10 ug
$300.00

Plasmid Map for RC203049

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC203049
Circular map for RC203049

file-alt Citations

Increased replication origin firing links replication stress to whole chromosomal instability in human cancer
Böhly, Schmidt, Zhang et al
Cell Rep (2022) 41 (11), 111836 DOI: 10.1016/j.celrep.2022.111836
Cited by 58
AI Summary: OriGene’s pCMV6-Myc-FLAG-GINS1 plasmid (Cat#: RC203049) was used to overexpress GINS1 in human cells, enabling the study to demonstrate that increased replication origin firing can induce whole chromosomal instability in cancer.
Snippet: pCMV6-Myc-FLAG-GINS1 OriGene Technologies, Inc., USA Cat#: RC203049
Inherited GINS1 deficiency underlies growth retardation along with neutropenia and NK cell deficiency
Cottineau, Kottemann, Lach et al
J. Clin. Invest. (2017) 127 (5), 1991-2006 DOI: 10.1172/JCI90727
AI Summary: OriGene’s anti-Flag antibody (clone 4C5) was used in this study to detect Flag-tagged proteins, contributing to the characterization of GINS1 deficiency and its cellular effects.
Snippet: Primary anti-Flag (OriGene, 4C5), anti-GINS1 (10R-1766, Fitzgerald), anti-GINS2 (A304-140A, Bethyl Laboratories Inc.), anti-GINS3 (15651-1-AP, ProteinTech),
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products